[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39477.1


[Show Plain Result]

## Summary of Sequence Search
   1::152
  10::136  5.9e-29 36.8% 0051590 00515901 1/1   sterase/thiol ester dehydrase-isomerase 
   1::139  7.5e-27 34.6% 0048478 00484781 1/1   sterase/thiol ester dehydrase-isomerase 
   1::136    1e-26 36.1% 0052559 00525591 1/1   sterase/thiol ester dehydrase-isomerase 
   1::137  1.3e-25 35.6% 0050180 00501801 1/1   sterase/thiol ester dehydrase-isomerase 
   7::139  1.4e-25 34.4% 0051358 00513581 1/1   sterase/thiol ester dehydrase-isomerase 
   2::142  1.9e-25 33.1% 0049396 00493961 1/1   sterase/thiol ester dehydrase-isomerase 
  13::141  4.3e-24 33.9% 0048889 00488891 1/1   sterase/thiol ester dehydrase-isomerase 
   1::137  9.8e-24 37.0% 0050179 00501791 1/1   sterase/thiol ester dehydrase-isomerase 
  12::140    2e-23 37.4% 0052350 00523501 1/1   sterase/thiol ester dehydrase-isomerase 
  15::143  1.9e-22 36.1% 0053001 00530011 1/1   sterase/thiol ester dehydrase-isomerase 
  18::139  4.7e-22 34.2% 0047497 00474971 1/1   sterase/thiol ester dehydrase-isomerase 
  11::144  1.4e-21 33.1% 0047466 00474661 1/1   sterase/thiol ester dehydrase-isomerase 
   4::134  3.3e-21 29.4% 0048813 00488131 1/1   sterase/thiol ester dehydrase-isomerase 
  30::137  2.2e-19 35.8% 0051233 00512331 1/1   sterase/thiol ester dehydrase-isomerase 
  30::138  3.6e-19 35.5% 0052965 00529651 1/1   sterase/thiol ester dehydrase-isomerase 
  36::147  4.4e-18 35.2% 0052966 00529661 1/1   sterase/thiol ester dehydrase-isomerase 
   3::138  1.1e-16 27.7% 0049564 00495641 1/1   sterase/thiol ester dehydrase-isomerase 
  32::137  1.2e-16 31.7% 0051338 00513381 1/1   sterase/thiol ester dehydrase-isomerase 
  28::137  1.8e-14 32.4% 0050275 00502751 1/1   sterase/thiol ester dehydrase-isomerase 
  23::135  1.6e-13 35.5% 0052592 00525921 1/1   sterase/thiol ester dehydrase-isomerase 
  33::142  2.2e-08 25.5% 0053213 00532131 1/1   sterase/thiol ester dehydrase-isomerase 
  35::145  2.1e-07 24.5% 0052780 00527801 1/1   sterase/thiol ester dehydrase-isomerase 
  37::138  2.2e-07 26.7% 0041428 00414281 1/1   sterase/thiol ester dehydrase-isomerase 
  33::135  3.2e-07 23.5% 0052351 00523511 1/1   sterase/thiol ester dehydrase-isomerase 
  33::138  6.9e-07 26.0% 0051839 00518391 1/1   sterase/thiol ester dehydrase-isomerase 
  36::135  4.3e-06 24.0% 0051494 00514941 1/1   sterase/thiol ester dehydrase-isomerase 
  35::142  3.5e-05 24.1% 0051794 00517941 1/1   sterase/thiol ester dehydrase-isomerase 
  29::149  0.00048 14.9% 0052337 00523371 1/1   sterase/thiol ester dehydrase-isomerase 
  35::142  0.00065 25.9% 0046019 00460191 1/1   sterase/thiol ester dehydrase-isomerase 
   1::152


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRESVFWKIADGRLPPPPCAETLGIEFLRVTPESGSIEVKFEATSAFLNLAGNVQGGFLAAMLDDTMGP
00515901   1/1  ---------llrallaldpfarllgielvevgdg..rvvlrlpvrprllnppGtvhGGalatlaDtaagl
00484781   1/1  mtlpe.llaallallaripfarllgielvelgd..grvvlrlpvrpehlnppGtvhGGalaalaDtaagl
00525591   1/1  lpglellpallrallagppfarllgielvevgdg..evvlrlpvrpehtnppGivhGGvlaallDeaagl
00501801   1/1  dmlllpellaallallaldpfarllgieivevgd..grvvlrlpvrprhlnppGtvhGGalaalaDtaag
00513581   1/1  ------msllldlpklldlelllaallakipfarllgirivelgd..grvvlrlpvrprllnppgtvhGG
00493961   1/1  -dmpllleelleallakipfarllgiriveldd..grvvlrlpvrpr.lnplGtvhGGalaalaDlaagl
00488891   1/1  ------------msilkldllaellallagipfarllgirlvelgd..grvvlrlpvrprhlnppGtvhG
00501791   1/1  dmllleellarllallalipfarllgielvevgd..grvvlrlpvrprhlnplGtvhGGalaalaDtaag
00523501   1/1  -----------elllerppflelllgirivevedge..vvlrlpvrpehlnplgtvhGGalaallDeaag
00530011   1/1  --------------allperypfllvdpfaellgdirivevedg..rvvlrlpvrpghlnphgivhGGvl
00474971   1/1  -----------------ripfarllgiriveledgr..vvlrlpvrpehlnppgivhGGalaallDeaag
00474661   1/1  ----------lldleeilellphrellg.rfvelsdge..vtlrlpvepahvlnpfgivhGgllaalldt
00488131   1/1  ---mpldleelleallarypflrllgiriveledgr..vvlrlpvrpehlnppgtvhGGalaaladeaag
00512331   1/1  -----------------------------elvevsdgrvvlrlpvrpehtnphGivhGGvllallDeaag
00529651   1/1  -----------------------------epleedgevvlrlpvrpehlnphGivhGGvlltlldeaagi
00529661   1/1  -----------------------------------g.vvlrllvrpehlnphgivhgGvlltlldeaagi
00495641   1/1  --mpdllqelldlllnliPlsralgikvvevgdgrleltaplapnl...nhhgtvfGGsiatladlaggg
00513381   1/1  -------------------------------evedgrvvlrllvrpedtnalGtvhgGvlltlldeaagi
00502751   1/1  ---------------------------lelvevedgrvtlrllvrpedtnalGivhgGvllalldeaagi
00525921   1/1  ----------------------llgdeiteldpg.kfatltldvnpehldnehgivhGgllfaladqaaa
00532131   1/1  --------------------------------lPlrlllllllarplldlpadgpftlrirVrpedtDan
00527801   1/1  ----------------------------------dlpftlrirVrpedtDanghvnngvylswfdearte
00414281   1/1  ------------------------------------pfvlelrvrpgdtDanghvnngvylelldearte
00523511   1/1  --------------------------------lsdlvftleirVrpsdtDanghvnngvylsyfeearte
00518391   1/1  --------------------------------ddplmsdlpftlrirVrpedtDanghvnngvylswfde
00514941   1/1  -----------------------------------fpfvleirVrfedtDaaGhvnngvylryfeearte
00517941   1/1  ----------------------------------dlpftlrirVrpsdtDanghvnngvylswfdearte
00523371   1/1  ----------------------------kpllklgltaeleltVteeltapflglggllsVlaTpalval
00460191   1/1  ----------------------------------mdpftlrirVrpedtDanghvnngrylswfdearte


                         -         -         *         -         -         -         -:140
query           ALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGELLQDDRVVATGTATAVIRRMG
00515901   1/1  aalallgegvvtvtvdlninflrparvgdltaearvvrvgrrlavvevevtddgklvatatgtfvv----
00484781   1/1  aalallgegvvtvtvdlninflrpvrvGtltaearvvrvgrrlavvevevydedgklvatatgtfvvld-
00525591   1/1  aalallg.ggrvvtvslninflrparlGdtltararvvkvgrrsavvevevtdeedgklvatatgt----
00501801   1/1  laalallgegvvvvtvdlninflrpvrvGtltaearvvrvgrrlavvevevtdedgklvatatlgtf---
00513581   1/1  alaalaDlaaglaallllgegvvvvtvdlnidflrparvgdtltaearvvrlgrrlqavvevevtddgk-
00493961   1/1  aallllgeegkrvvtvdlninflrpar.Gdltaearvddelldailellvkvgrrlavvevevydedgkl
00488891   1/1  GalaalaDeaaglaallllpelggrvvtaslninflrpvrvGtltaearvvrvgrrsavvevevydedge
00501791   1/1  laalallgaggrvvtaslninflrparvGtltaearvvrvgrrlavvevevydedgklvatatgtfv---
00523501   1/1  iaalrllg.gklvvtasldinFlrpvrvGdtltaearvvkvgrrsavvevevydeedgklvatatgt...
00530011   1/1  aalldeaagiaalallg..grvvtasldidflrpvrvGdtltaearvvrvgrrsavvevevyddgelvae
00474971   1/1  laallllg....vvtasldinflrpvrvGdvltaearvvrvgrrsavvevevtdegklvaeatgt..vd-
00474661   1/1  aagiaa.....pgklvvtasldinFlrpvrvGdtltaearvvkvvgrslv.vevevydegklvatatgtf
00488131   1/1  laalll...gkrvvtasldidflrpvrvGdtltaearvvrvgrrsavvevevydedgklvatat------
00512331   1/1  iaaarhl..ggrvvtvsldnidFlrPvrvGdvltaearvvrvgrssavvevevyvedlldgegklva---
00529651   1/1  aaasl..aggrvvtvsldnidFlrpvrvGdvltaearvvkvgrssavvevevyvedlldgegrlvata--
00529661   1/1  aalsll..garvvtvsldnidFlrPvrvGdvltaearvvkvgrssivvevevyvedlltgegrlvatatf
00495641   1/1  aalllldeaglggdvvtadlninflaPvtggvtavaelpeeflarllrrgrrrvvvevevyddgklva--
00513381   1/1  aaarhagg..rvvtasvdninFlkPvrvGdvleaearvvkvgrssmevevevyaedllsletgegrl---
00502751   1/1  aaarha..ggrvvtasldsidFlrpvrvGdvlevearvvrvgrssmevevevyvedlldgdgklvae---
00525921   1/1  aal....n.glvavtgslnvrFlrpvkpGdtlvaearvlkvggrsvvvevevynevggelvaege-----
00532131   1/1  Ghvnngvylrwldeartallrrlglldllesglglvvveleidylrpvrlgdvltvetrvvrvgrssltv
00527801   1/1  flrrlgldllaaglglvvvsleidylrpvrlgdvltvetrvvrvgrtsltveqeifrededgelvataet
00414281   1/1  llrelglal.allegglglvvaeleidyrrpvrlgdvltvetrvlkiggrsltveveirdledgelva--
00523511   1/1  flrr.lgldlarglglvvaeleidylrpvrlgdelevetrvvklgrssltleveifrdgelvatg-----
00518391   1/1  arteflralg..laalrasglglvvvsleidflrpvrlgdvltvetrvvrvgrssltvevevfregdg--
00514941   1/1  flrelglsyaallaeglglvvveleidylaparlgdvlevrtrvvelgrssltfeyeifrdgell-----
00517941   1/1  llerlgldllasglglvvvsleidylrpvrlgdvltvetrvvevgrtsltvevevfrengdgelvataet
00523371   1/1  mElaaleallpfleegettvgtevnvkHlaptpvGetvtvtaelvevegrrlvfeveafdeegeligegr
00460191   1/1  flrelglglllaallaeglvglvvvsleidylrpvrlgdvlevetrvvkvgrksltleqeifnedllgdg


                         +         -         -         -         -         *         -:210
query           TQTAWAAAQKPA----------------------------------------------------------
00515901   1/1  ----------------------------------------------------------------------
00484781   1/1  ----------------------------------------------------------------------
00525591   1/1  ----------------------------------------------------------------------
00501801   1/1  ----------------------------------------------------------------------
00513581   1/1  ----------------------------------------------------------------------
00493961   1/1  va--------------------------------------------------------------------
00488891   1/1  l---------------------------------------------------------------------
00501791   1/1  ----------------------------------------------------------------------
00523501   1/1  ----------------------------------------------------------------------
00530011   1/1  atg-------------------------------------------------------------------
00474971   1/1  ----------------------------------------------------------------------
00474661   1/1  vavd------------------------------------------------------------------
00488131   1/1  ----------------------------------------------------------------------
00512331   1/1  ----------------------------------------------------------------------
00529651   1/1  ----------------------------------------------------------------------
00529661   1/1  tfvavd.---------------------------------------------------------------
00495641   1/1  ----------------------------------------------------------------------
00513381   1/1  ----------------------------------------------------------------------
00502751   1/1  ----------------------------------------------------------------------
00525921   1/1  ----------------------------------------------------------------------
00532131   1/1  ev--------------------------------------------------------------------
00527801   1/1  tlvav-----------------------------------------------------------------
00414281   1/1  ----------------------------------------------------------------------
00523511   1/1  ----------------------------------------------------------------------
00518391   1/1  ----------------------------------------------------------------------
00514941   1/1  ----------------------------------------------------------------------
00517941   1/1  tl--------------------------------------------------------------------
00523371   1/1  htravvdle-------------------------------------------------------------
00460191   1/1  el--------------------------------------------------------------------