[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39592.1


[Show Plain Result]

## Summary of Sequence Search
   1::263
  84::251  4.5e-31 32.1% 0048178 00481781 1/1   omain-like                              
  79::251  4.9e-31 31.2% 0049595 00495951 1/1   omain-like                              
  66::251  6.1e-31 30.7% 0049608 00496081 1/1   omain-like                              
   8::82   1.1e-10 36.5% 0048177 00481771 1/1   ed helix" DNA-binding domain            
  16::79     2e-05 32.3% 0043062 00430621 1/1   ed helix" DNA-binding domain            
  16::81   8.3e-05 33.9% 0044139 00441391 1/1   ed helix" DNA-binding domain            
  15::81    0.0001 26.9% 0046839 00468391 1/1   ed helix" DNA-binding domain            
  12::69   0.00034 24.6% 0047523 00475231 1/1   ed helix" DNA-binding domain            
   1::263


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTDEASPGPLARYIDVLEVIAAFSGAITLADVSSILDLPKTTAHRLLKGLVRAGLAVEGDAGRSYYVGE
00481781   1/1  ----------------------------------------------------------------------
00495951   1/1  ----------------------------------------------------------------------
00496081   1/1  -----------------------------------------------------------------YrLGl
00481771   1/1  -------vqsleraldiLellaeaggplslselaealglpkstvhrlLatLeelglverdpdg.ryrlgl
00430621   1/1  ---------------gildlLa..dgpltvaeLAerlglspsalsrlLrlLaslglveedgegrrvyrlt
00441391   1/1  ---------------gildlLa..dgpltvaeLaaalgldpsllsrlLralvalglveededgr..yalt
00468391   1/1  --------------lgipdiianaggplslseLaaalgldpskapvLrrllRlLvslgifaedgegerlY
00475231   1/1  -----------dleekilelLkeageplsaleiakelglpkkevnrlLyeLkkeglvvs.pkpplWllg-


                         -         -         *         -         -         -         -:140
query           RLTRLLHAGADDGWYASLAGPHLRALTEASTETCYLARLIGSRVVVALSYSPDVRWRGYVQPGIEMPVNA
00481781   1/1  -------------dlrelarplLeeLaeetgetvhLavldgdevvyvarvesprplrvslrvGsrlplha
00495951   1/1  --------ylssldlvelarplleeLaeetgetvhLavldgdeeevvyvarvesprplrvslrvGsrlpl
00496081   1/1  alle.......sldllelarpvleeLaeetgetvhlavldgdevvylarvesprplrvslrvGsrlplha
00481771   1/1  rllelglaales----------------------------------------------------------
00430621   1/1  pvsrlLldd-------------------------------------------------------------
00441391   1/1  plsklLlsdsp-----------------------------------------------------------
00468391   1/1  altpvsrlLlk-----------------------------------------------------------
00475231   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AATGKAIMAFQSKVLIAEALSHELPKPTINSHTSRKWIEQEFAKVRTNGYATCIGEIDEGLAAIAVPVRL
00481781   1/1  tAsGkallaflpeeeleallarlelealtpntitdldallaelaeirerGyavdlgelepgvaavAvPvf
00495951   1/1  hatAsGkallaflpdeeleallarlelealtpntitdleallaelaeirerGyavddgelepgvaavAaP
00496081   1/1  tAsGkallaflpdeeleallarlelealtpntitdlaallaeleeirergyavdlgelepgvsavAaPvf
00481771   1/1  ----------------------------------------------------------------------
00430621   1/1  ----------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00468391   1/1  ----------------------------------------------------------------------
00475231   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PNGAVLHSVGMTGPLERIMNKQLSTRLAALRATAATLAKALALGSTIKQRSSS-----------------
00481781   1/1  dadgrvvaalsvsgpasrldaerleelaplLleaareisar-----------------------------
00495951   1/1  vfdadgrvvaalsvsgpasrldaerleelapllleaareis-----------------------------
00496081   1/1  dadgrvvaAlsvsgpasrlteerleelapllleaareisaa-----------------------------
00481771   1/1  ----------------------------------------------------------------------
00430621   1/1  ----------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00468391   1/1  ----------------------------------------------------------------------
00475231   1/1  ----------------------------------------------------------------------