[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39597.1


[Show Plain Result]

## Summary of Sequence Search
   1::235
   1::236  6.7e-58 39.6% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   1::234  1.1e-57 40.2% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   1::225  6.4e-55 40.6% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   2::221  2.8e-54 39.8% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   1::232  4.1e-54 38.8% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   2::233  3.9e-53 36.6% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   1::225  4.5e-53 40.7% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   1::225  4.8e-53 39.7% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   2::233  5.1e-53 35.6% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   2::233  1.1e-52 35.6% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   1::235  1.3e-52 39.1% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   1::233  2.1e-52 38.9% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   1::222  2.6e-51 39.6% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   6::221  2.9e-51 36.4% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   2::225    3e-51 40.9% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   2::228  3.4e-51 39.3% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   2::221  3.8e-51 38.8% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   2::233  4.1e-51 39.1% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   1::233  4.5e-51 39.3% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   3::234  8.5e-50 40.2% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   1::223  2.1e-49 39.4% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   1::225  7.8e-49 38.1% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   7::221  9.3e-48 41.0% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   1::228  1.2e-46 38.7% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   1::209  1.3e-46 40.9% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   1::222  1.2e-45 38.6% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
  22::231    6e-42 44.4% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
   1::227  1.4e-41 39.1% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   1::230  3.2e-41 37.0% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   1::227  3.7e-41 39.5% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   4::229  3.4e-40 37.4% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
   1::226  4.3e-40 34.1% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
  19::232  7.3e-40 39.1% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   1::225  1.6e-39 38.8% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   1::222    6e-39 34.4% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   1::204  6.2e-39 33.5% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
  17::232  7.1e-39 43.0% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  10::232  6.9e-38 35.5% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   1::236  9.7e-37 35.3% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   1::222  1.2e-36 36.2% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   1::233  3.2e-36 36.9% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   9::224  1.2e-34 37.4% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   1::217  2.3e-34 37.7% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
   1::232  1.1e-33 37.9% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  27::182  8.1e-33 36.4% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  14::225    3e-32 39.3% 0053253 00532531 1/1   arboxykinase-like                       
   1::227  7.3e-31 34.0% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  12::200  1.5e-30 37.5% 0047841 00478411 1/1   arboxykinase-like                       
  25::218  9.1e-30 44.6% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  28::221    3e-29 38.8% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  16::215  6.2e-29 35.3% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   1::222  7.4e-29 34.4% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  27::222  4.3e-28 34.4% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  13::184  4.7e-28 40.9% 0047552 00475521 1/1   arboxykinase-like                       
   1::121  7.8e-25 37.3% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  21::166  5.6e-24 34.3% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  25::210  1.3e-23 32.8% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  26::188    2e-22 31.9% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  11::215  2.5e-22 34.0% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
   2::227  2.7e-22 35.8% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  26::185  3.6e-22 29.6% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  25::213  3.8e-22 33.3% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
   5::235  1.3e-21 32.1% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  27::209  1.3e-21 29.4% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  26::229    2e-21 32.8% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  27::171  3.3e-21 38.3% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
   4::221  5.3e-21 31.2% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  24::225  5.8e-21 30.9% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  19::235  5.9e-21 29.1% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  12::195  6.3e-21 28.6% 0047844 00478441 1/1   arboxykinase-like                       
  27::216  1.6e-20 29.1% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  16::235  5.5e-20 27.1% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  26::190  6.2e-19 33.1% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  24::214    2e-18 28.2% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  24::213    3e-18 33.8% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  24::214  6.6e-18 31.4% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  23::235  2.2e-17 29.0% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  11::191  6.1e-17 34.5% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
   1::209  1.4e-16 28.1% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   5::191  1.4e-16 25.4% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  21::217  2.8e-16 22.6% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  27::218  6.1e-16 29.6% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
   6::194  1.2e-15 30.0% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  14::210  2.3e-15 36.6% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  22::193  2.9e-15 26.0% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  28::191  2.4e-14 23.6% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  27::232  3.7e-14 24.4% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  24::212  1.4e-13 25.5% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  27::174  9.6e-13 27.3% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  14::213  9.9e-13 27.7% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
   4::193  1.4e-12 23.7% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  16::162  1.9e-12 29.5% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  20::189  2.7e-12 28.0% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   7::213  3.1e-12 32.9% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  21::191  4.6e-12 35.2% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
   7::191  2.2e-11 32.2% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  28::217  4.2e-11 20.3% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  27::217  3.8e-10 24.2% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  28::162  4.7e-10 25.4% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  26::187  6.7e-10 28.6% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  16::223    1e-09 29.2% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  14::205  1.5e-09 33.3% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  19::217  3.4e-09 22.6% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  20::191  5.2e-09 30.8% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  16::73   3.5e-08 36.2% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  24::213  7.8e-08 27.7% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  27::172  9.7e-08 36.3% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  18::176  1.3e-07 39.1% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  25::165  1.5e-07 29.0% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  22::211  1.6e-07 25.3% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  16::199  3.1e-07 29.8% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  20::191  3.6e-07 30.1% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  21::212  4.3e-07 23.3% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  11::49   5.3e-07 43.6% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  16::191    1e-06 23.9% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  15::191  2.2e-06 26.9% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  27::232  2.4e-06 21.9% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  23::70   2.8e-06 31.2% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
   2::162  3.3e-06 29.8% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  26::162  5.5e-06 36.6% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  23::213  6.4e-06 26.9% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  22::194    1e-05 27.4% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  20::162  1.2e-05 30.1% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  27::162  1.3e-05 30.8% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  26::169  1.5e-05 31.6% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  16::59     3e-05 38.6% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  12::49   4.8e-05 39.5% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  27::179  5.7e-05 25.2% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  23::179  8.8e-05 35.7% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  21::209  0.00016 29.2% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00016 45.8% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
  27::209  0.00016 24.8% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  16::185   0.0002 26.5% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  23::174   0.0002 24.7% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  27::71   0.00022 35.0% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
  16::162  0.00023 37.5% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  21::207  0.00026 26.1% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  13::162  0.00032 31.4% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  22::58   0.00061 37.8% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  27::58   0.00068 40.6% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  26::162  0.00084 30.8% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
   1::235


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST
00475891   1/1  lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00379581   1/1  lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldita
00378981   1/1  lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllll
00422801   1/1  -llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkll
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00458601   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditgl
00500441   1/1  lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdi
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00490801   1/1  -llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalvG
00510251   1/1  -lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeival
00475991   1/1  lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGe
00482201   1/1  llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00466971   1/1  llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdil
00390411   1/1  -----MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirr
00425571   1/1  -lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl
00502741   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00367901   1/1  -lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilk
00482261   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00530591   1/1  llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkp
00404101   1/1  --elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltalsl
00361211   1/1  plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlld
00509431   1/1  Mlelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdli
00466931   1/1  ------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdila
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTt
00436071   1/1  pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla..
00424961   1/1  lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliaglldpd
00485931   1/1  ---------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi.....
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00469451   1/1  allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdv
00372301   1/1  yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggil
00496111   1/1  ---elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglelsa
00495371   1/1  esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlvd
00468601   1/1  ------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaa
00379601   1/1  llelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel....
00488521   1/1  lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei.
00436511   1/1  ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikkGe
00448931   1/1  ----------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla.
00485451   1/1  ---------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggk
00367481   1/1  yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllpas
00500611   1/1  pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeil
00422141   1/1  dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlieliflde
00503371   1/1  --------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgk
00464791   1/1  lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkGer
00371631   1/1  mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgk
00381441   1/1  --------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlge
00532531   1/1  -------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinlegg
00437981   1/1  lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkd
00478411   1/1  -----------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvrlgl
00414121   1/1  ------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidg
00512891   1/1  ---------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv.....
00475371   1/1  ---------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrpsa
00495031   1/1  lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplggk
00457311   1/1  --------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddly
00475521   1/1  ------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlvdlep
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00480471   1/1  --------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeill
00477971   1/1  ------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttr...pp
00515531   1/1  -------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgv
00462761   1/1  ----------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr.
00437941   1/1  -lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvl
00515511   1/1  -------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgv
00426051   1/1  ------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlgg
00489571   1/1  ----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt..............
00533501   1/1  --------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp
00493431   1/1  -------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpg
00475381   1/1  --------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavl
00503741   1/1  ---fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLakl
00464411   1/1  -----------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgepl
00490731   1/1  ------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaa
00478441   1/1  -----------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvll..
00496571   1/1  --------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirge
00368501   1/1  ---------------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlL
00484101   1/1  -------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldl
00510561   1/1  -----------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDl
00468951   1/1  -----------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgika
00498531   1/1  -----------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDa
00487021   1/1  ----------------------rm...kiivltGpsGsGKsTlarlLaell....gvvvidtddllra..
00379961   1/1  ----------vGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdll
00434401   1/1  M.....lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpa
00477011   1/1  ----eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrl
00470731   1/1  --------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlar
00405881   1/1  --------------------------gervglvGrpgaGKSTLlnaltglk.aivsgypgttldpnlgvv
00368571   1/1  -----glgvllGkll..dgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkgey
00404191   1/1  -------------vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakala
00451571   1/1  ---------------------MsikkgeiiaivGppGsGKsTlaklLakllglivldgddl.........
00513761   1/1  ---------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDparanl
00532471   1/1  --------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvge
00439861   1/1  -----------------------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqla
00499191   1/1  --------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd..........
00513251   1/1  -------------iellsdlslsipspevvllvGppGsGKstlakklaellgfilidaddlr........
00356411   1/1  ---lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvkl
00379261   1/1  ---------------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLv
00508671   1/1  -------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvv
00392701   1/1  ------lealagarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd........
00432181   1/1  --------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvv
00406781   1/1  ------lealaglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase........
00480441   1/1  ---------------------------rlivllGpsGaGKsTlaklLaellp...glivisvgdttr.ep
00498811   1/1  --------------------------kPgkiigltGpsGsGKsTlarlLael........gvividgddl
00469161   1/1  ---------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtpl
00489631   1/1  -------------------------MkgklillvGppGsGKtTlaraLaellglpf..iridgddllrel
00394721   1/1  ---------------aleallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvrl
00386741   1/1  -------------lealkavllgirpgehllLvGppGtGKTtlaralagelgapfvrlda..........
00480251   1/1  ------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyrps
00517691   1/1  -------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg........
00495771   1/1  ---------------alldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrhtTr
00482551   1/1  -----------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaana
00515351   1/1  --------------------------mngklivltGppGsGKtTlaraLaerlglpvistddllreav..
00420941   1/1  -----------------lglslgirpgkgvllyGppGtGKTtlakalagelgapfiridg..........
00461621   1/1  ------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddly........
00499331   1/1  ---------------------PslslkkgklivltGppGsGKtTlakaLaerlglpfidtddllrepvig
00444381   1/1  ---------------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspa
00409841   1/1  -------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv.
00533151   1/1  --------------------MsldikkgklivltGppGsGKtTlarlLaerlglpfistddllrelvpgg
00410321   1/1  ----------yggllllkdlslelkkglkilllGlngaGKTTllnrllg---------------------
00437921   1/1  ---------------alerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldasdl
00410531   1/1  --------------gelknlslelkkglkillvGlngvGKTtllkrlag.....................
00478081   1/1  --------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrrea
00420081   1/1  ----------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrs
00367291   1/1  -vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel.......
00402371   1/1  -------------------------pgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrlda
00401211   1/1  ----------------------elkrglnvgivGhvgaGKSTLlnaLlgll...................
00521551   1/1  ---------------------lglrpgkgvlLvGppGtGKTtlaralagllgapfvrlsas.........
00437901   1/1  -------------------lslgirpgrillLyGppGvGKTtlakalakel.....gapvieidaselrd
00476071   1/1  --------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll..
00519581   1/1  -------------------------kpkvilltGppGvGKttlarlLakllglpliidldalaellfgdv
00471271   1/1  ---------------prailelesliksllekllellkrlslklkkglkvalvGrpgvG-----------
00378621   1/1  -----------glklllrrlslllkkglkvllvGlpgvGKstllnrlag---------------------
00482721   1/1  --------------------------kgkiigltGpsGsGKsTlarlLaelglpvidtddlyrel.....
00472911   1/1  ----------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageg
00511381   1/1  --------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtrl.
00403151   1/1  -------------------------kglkivlvGdsgvGKTtLlnrllg---------------------
00457851   1/1  --------------------------PkgklivltGppGsGKtTlakaLaerlglpvistddllre....
00527261   1/1  ---------------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel
00478391   1/1  ----------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddllrel
00523461   1/1  --------------------------a.kvalvGlpnvGKStLlnallgdk.aivsdipgitrdiqtgtl
00473941   1/1  ---------------vkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga..........
00516041   1/1  --------------------mlk...gklillvGppGsGKtTlaralaeelglpfvvidaddl.......
00416171   1/1  ------------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvn
00489391   1/1  ---------------------lsikkgklivltGppGsGKtTlakaLaerlglpvist------------
00496061   1/1  --------------------------gklivltGppGsGKtTlaklLaerlglpvist------------
00487061   1/1  -------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvd


                         -         -         *         -         -         -         -:140
query           DRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLSGGE
00475891   1/1  lglsllellrrgigyvfqdpalfpgltvlenlllgll.llglalkeaalralllllllgletlldrlvse
00379581   1/1  lslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellelvgl
00378981   1/1  slaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellell.glddlldrlvge
00422801   1/1  agllkptsGeilldgldilalslae.lrrrigyvfqdpalfp.ltvrenlalglllallllglskaeara
00440861   1/1  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00458601   1/1  spqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllgl
00500441   1/1  ldlsl...lrrgigyvfqdpalfpgltvlenlllgll.llglslaeaaeralelllllgledlldrlvse
00420701   1/1  llslaellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellell.glddlldrlvg
00490801   1/1  pnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll............
00510251   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00475991   1/1  illdgkdildlslael..rgigyvfqqdallpsltvlenlllglllagellllllaakeaalrallllll
00482201   1/1  slkel..rgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlps
00466971   1/1  glslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletlld
00390411   1/1  gadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrg
00425571   1/1  ...lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellell.glddlldrlvgeLSgGq
00502741   1/1  slael..rgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellell.gledlldrlpseLSg
00367901   1/1  gllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrr.ligyvpqdpalfpq
00482261   1/1  slael..rgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrlp
00530591   1/1  tsGeilldgkditdlslkel..rgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralll
00404101   1/1  ael.rrgigyvfqdpalfpgltvrenlalgll.....kaeararalellell.gldelldrlvgeLSgGq
00361211   1/1  gleisalslaerlragigyvfqdlalfpeltvlenlalg.............rarellerlglail..dr
00509431   1/1  flgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrr.ligyv
00466931   1/1  lspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallldll
00498251   1/1  Lalrllagllkpgggvvyidgeesldll....rarrlgvvlqelllfpeltveenl..............
00436071   1/1  ....lrrgigyvfqdpalfpgltvlenlalgllllgll..ealaralellellglgdl..drlvseLSgG
00424961   1/1  sgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyfrdegadvllladsll
00485931   1/1  .....rrigavpqlpvlfprltvlenlalg.......gadlaeraeellell.glegfdvvliDtagrgr
00468691   1/1  vglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelre...lrrrigyvfqdpalfpeltvlenlal
00469451   1/1  lylsleesleq.lrrrigyvfqdpalfp.........................aeellelvg.ledlldr
00372301   1/1  vdgedlrigyvfq..............................................llervgledll
00496111   1/1  eelrerr.rrigyvfqepalfpeltvlenlalgll...........................drlpgeld
00495371   1/1  gldltglspa...rggiglvfqteallppltvrenlealgldlrglldrerviellelvgleelldrlpr
00468601   1/1  ae..rlgigavpqdvplfpsltvldnlalar...dlleaakaagydvvlidtaglld.ldrlvgelsggq
00379601   1/1  ...lrnkigyvfQdpvlfp.ltvren............................................
00488521   1/1  ...............ggkvlyvdqeeslfp.ltvlenlalg...........gedveellerlgl..dll
00436511   1/1  rvglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpa
00448931   1/1  ...areqlgivfqd....pgltvlenlalg.........eleararellell.gledydvvliDtagrlr
00485451   1/1  vlvigldifrlsarelrkrigvfqdpa...llphltvpenldlglll......eilervlellelvgldv
00367481   1/1  ggilvpgedalll.............................................rvdeiltrvgls
00500611   1/1  lggkvlyisleeslrrrrigmvfqelgldpdltv....................arerviellelvglle
00422141   1/1  eellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlgl
00503371   1/1  dlliylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeli
00464791   1/1  vglvGpnGaGKTtLlkllagllkpdsgeivvyg.ligerpre.........vrellglllelgvlf....
00371631   1/1  lalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeql..krigllf
00381441   1/1  vdgvdltfls.....reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeelle
00532531   1/1  fyakaigllrrkigyvfq...lfpfltvlenvalgld..glvdeedleraenllalvgleeipnrypse.
00437981   1/1  i.........rrgiglvfqliglfphltvlelvalgl...ggilveevrellkel...............
00478411   1/1  kd....gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvg.lddlldrypdelsgg
00414121   1/1  qll.edlgvlavrlgigyvpqtlglfpaltvlellalall...........................lre
00512891   1/1  .rsarrgigyvfq........tveellgllaelvgle.............vrgeleellktlikelsgge
00475371   1/1  rellg..........................................llgellgldvlvgarggdlsggl
00495031   1/1  vlyiglelt.lsperlrlraqsl...........................gldldellerllvidllelv
00457311   1/1  klsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk.........llepvglpevldry
00475521   1/1  lrr...digmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp...sg
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyv-------------------
00480471   1/1  dgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpvil
00477971   1/1  rpgevdgvgyvfqsrelfpeltvagnflegaevrgnlygtsrerveellea..gldvlldidpqglsggq
00515531   1/1  klqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpi
00462761   1/1  ......lglliglvfqdpdllpfltvlenvllpllaagliv..ivdgtlllvglrealrkll...gl.ls
00437941   1/1  gidaselld.............................................................
00515511   1/1  klqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpi
00426051   1/1  esglllrdlrrl.iglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviellleg
00489571   1/1  ......................................................................
00533501   1/1  .....lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlaydg
00493431   1/1  evr...gigyvfqsgalfphlivagnllegaevhgllygtskerveeale.........kgllvlldrdl
00475381   1/1  srdllgllreglirigyvfqdyalfprltvlenvllgll.........................llgglv
00503741   1/1  lagllkpkfgeillfgkvvyvnvselldlkellrll..................................
00464411   1/1  ge....ligevfqdgilfpdltvlenvalgrygll..glikealaegvivildrvglsdlaypgflsgge
00490731   1/1  dellgvlaee..........................................lgldvllgarggdlsggl
00478441   1/1  .elrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld....drypyelsgg
00496571   1/1  plgelir...glvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvg.lsdlaygfprtls
00368501   1/1  vGppGvGKTtlaralakllgapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvle
00484101   1/1  dellg..igylfqdvgllpvltvrenlal...llrglpgysaeeleralellelagfdvilieGllelal
00510561   1/1  llgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql...rarrlgldldrlll
00468951   1/1  LDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid....teesldqlrarrlgldld
00498531   1/1  llgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql...rarrlgldldelll
00487021   1/1  ........gevfqdyalfphltvlelldnvllgleirgllk...aerlervevllervgllldrippals
00379961   1/1  dpkdlrellragiplvflnfaalpasllesel......................................
00434401   1/1  aelllreglgidfqlpdal......................drellreevlellglgevvivdvydlsgg
00477011   1/1  setpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdltlv
00470731   1/1  alakel.....gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpdvild
00405881   1/1  eldd.............grqlvlvDtpGliel..aslgeglvrqalealeradvillvvdasdplldqpv
00368571   1/1  aglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilalae
00404191   1/1  nelkkrggrvlyvsa.......................................................
00451571   1/1  .....lreaiglvtqdgelll..elidegilvpdeiviellrealeeldadgvildgfprllgqaellls
00513761   1/1  peqlgi......dirdlidletvmelglgpngalvfaleellttldillealelleedydyiliDtpGgl
00532471   1/1  lggaalldivde..grliglvfqdldllpllevlellaa........................rleelle
00439861   1/1  anlakn.......ggkvlyisleesreqlleraerlgldleellllgllsiliad...............
00499191   1/1  .....gllvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalveglvvlldryprlls
00513251   1/1  ......................................................................
00356411   1/1  tlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi.i
00379261   1/1  GppGvGKTtlaralAkllgapfvevdaselteggyvgedlekr.irelfqearllvfltvlenirldase
00508671   1/1  lldgddlraglsiglilsdedraalrrr.lgevfqelllagrlvvldgtalgl.elrdelrellkeaglp
00392701   1/1  .........................................................llgkyvgelsggl
00432181   1/1  eldgrkl..........................................................vliDt
00406781   1/1  .........................................................llgkyvgelsggl
00480441   1/1  regevlgvdyvfvdrelfeelivagnlledaivhgllygtskerieealda..glgvlldgfprglsqaq
00498811   1/1  trelvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldll.gldvvi
00469161   1/1  gelirelllegfqdlilvpdllvlellaanraglrelikellaagkgvildrfp.....lsrlayqlsgg
00489631   1/1  lgellgrgigfgfqqgdlledatvlenlalllldeidka....................ledggvvlldg
00394721   1/1  dlsellsv.....................................................sdlvgeleg
00386741   1/1  ...............................................................selsgge
00480251   1/1  apeqlgi.lgellgvp.vvgvltgldlagalrealell....................llegydvvliDt
00517691   1/1  .........................................gtlllllgllsfllalvldslplerergi
00495771   1/1  dvl-------------------------------------------------------------------
00482551   1/1  alplelgklggkvlyisteeafsperlreralsl........gldleelldrllvidatdlldlleller
00515351   1/1  .......pggtdigelfqdyllfpfltvdeni........................rglllealeellaa
00420941   1/1  .......................................................sellgkyvgelsggl
00461621   1/1  ....revvergtelgklikdyfdpgalvpd.llirlllerllfldegggflldgfprtleqaealskpav
00499331   1/1  ....agtdigevfqdlll....aggllvddev........................rrlllealdellla
00444381   1/1  irrllellgarpgenvlLvGppGtGKTtlakalakllgvpfiridgseltekelvGe.............
00409841   1/1  ......................................................................
00533151   1/1  ldig.............evfqda.leaglllfddefrglller...................leellarg
00410321   1/1  ----------------------------------------------------------------------
00437921   1/1  rgvddlreligevlqalglllgg...............................................
00410531   1/1  .............gefvdygptigvnfktvevdgvkl........................viwDtaGqe
00478081   1/1  irelllgldlleilf................................................eglllsd
00420081   1/1  ----------------------------------------------------------------------
00367291   1/1  ...gapfirvdasellek....................................................
00402371   1/1  selle.....................................................fgkyvgafeggl
00401211   1/1  ..........................................................ldtlkgelergi
00521551   1/1  .................................................elvg.........kyvgeleg
00437901   1/1  .......................................................vddlsgyvgelsgge
00476071   1/1  .....................ggpllerirellgegyllfdeal......drellaallfglelegalld
00519581   1/1  gglvvdli..............................................................
00471271   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482721   1/1  ......vaggtplgerirellgegyllpdealfrallaellfgdll.alalldgvv.ydrlrdellaels
00472911   1/1  gkpl.........................................................gllfedale
00511381   1/1  gielvvsriglvleavglffaldllelll.........................................
00403151   1/1  ----------------------------------------------------------------------
00457851   1/1  .avpggtrlgeviqdlfllggllffdeldellkerieellaag.gvild................gfpld
00527261   1/1  gkpviyidlselsskgyvdleellrela..........................................
00478391   1/1  vgeggrlgrdlfdedrllfrel.lideidl........................................
00523461   1/1  e---------------------------------------------------------------------
00473941   1/1  ......................................................pfielsasdllg...e
00516041   1/1  ...lrgeelgriielfdearelvpelallfideidell...........................akgkv
00416171   1/1  csalte...............................................................d
00489391   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  ywaavgggdllrlirelllrlg.............................fgepdafdnellgelleal


                         +         -         -         -         -         *         -:210
query           QQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET
00475891   1/1  LSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrladri
00379581   1/1  dtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvthdl
00378981   1/1  LSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladr
00422801   1/1  ralellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrela
00440861   1/1  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlf
00458601   1/1  edlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdl
00500441   1/1  LSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrladr
00420701   1/1  eLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrlad
00490801   1/1  lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetrael
00510251   1/1  ..lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetra
00475991   1/1  lgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvt
00482201   1/1  eLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsea.rladr
00466971   1/1  rlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealr
00390411   1/1  iglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllellegl
00425571   1/1  rqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvld
00502741   1/1  GqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvl
00367901   1/1  ltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeellel
00482261   1/1  seLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlseal.lad
00530591   1/1  llllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvl
00404101   1/1  rqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrlad
00361211   1/1  lpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvth
00509431   1/1  pqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeeleligpll
00466931   1/1  lllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvstL
00498251   1/1  ..................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrl
00436071   1/1  qrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladrivv-
00424961   1/1  rlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDeptsa
00485931   1/1  rvgelsggqkqrvaiarallllldpelllldEptsglda.....lrlllellkelgltvlvvthddgtak
00468691   1/1  gallag.................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldal
00469451   1/1  lpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH..
00372301   1/1  drlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlela
00496111   1/1  lSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdleeae
00495371   1/1  e....lsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdleev
00468601   1/1  kqrvaiarala.apevllldeptsglda..laellelleel...gltvlvvtKlDgtakgghdlslalrl
00379601   1/1  .....laralrqdPdilllDEptsalda.......ellqallt.ghtvvlvthhlntaldladriivldd
00488521   1/1  drlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakel
00436511   1/1  llrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftlls------
00448931   1/1  lpselsggqkqrvaiaralaaplppevllldeptsglda.....lrellellrelgltvlvvthlDllak
00485451   1/1  vlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvth
00367481   1/1  dlldrgls..lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtH
00500611   1/1  lldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvth
00422141   1/1  sygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp.............ie
00503371   1/1  ellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkelekr
00464791   1/1  ...............aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEptsgl
00371631   1/1  q.kglpealdveell......................ellldlkegledilvpvlsggqkqrlalaralv
00381441   1/1  llgldadlviilpasleellerldrrggelsggqkqRvalar----------------------------
00532531   1/1  lsgGqqqrv...........illldEPtsgLdpvsr...........................leladri
00437981   1/1  .lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlsellpalls
00478411   1/1  qrqrvaiaralalepelllldeptsaldplavvellelllglnee.ldiilalellllde----------
00414121   1/1  dpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnK
00512891   1/1  kqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldel.eladriallrr
00475371   1/1  rqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadril
00495031   1/1  gllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilv
00457311   1/1  phelsgGqrQRv...ralaldpdllilDeptsalgqpdpelrelldllifldadlgltlirlitrdlgea
00475521   1/1  gqqqeilrvaiallilpvllgralallpelllldeptsaldpdl--------------------------
00387201   1/1  ----------------------------------------------------------------------
00480471   1/1  llnkidllddrllrraeaeerieell--------------------------------------------
00477971   1/1  kqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdleealelldrilvll
00515531   1/1  llvlnKiDlleakeraeellellgl.gdlldklpselsgGqkqrvala----------------------
00462761   1/1  gGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdls.ieeva
00437941   1/1  .pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrleeldpa
00515511   1/1  llvlnKiDlleaklvlll.lvglfdlldglpselsggqkqrvala-------------------------
00426051   1/1  ldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeelleller
00489571   1/1  .lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth.ldeaer.aDrvavl
00533501   1/1  fprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehylelle-
00493431   1/1  sggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleea
00475381   1/1  vildggvrqrlalarallldpdvllldepll---------------------------------------
00503741   1/1  ............lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLl
00464411   1/1  qqrvaiarallpkpdlvllldepteeldeRllkRg....rllekleyikkrlehylelaepykddvvvid
00490731   1/1  rqr..larallgdydvliiDtpgt.ldvllelallellkellaelgadvvllvvdatlgleaadrilvll
00478441   1/1  erqrvailr..vllpklllpdepgrnldvlievavlnlilkllgidallelvdrl---------------
00496571   1/1  glgqrqrvalarallkpdlvifldeppteeldeRlrkrl........rlgdteevlehrleraeeladrl
00368501   1/1  nlalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgg
00484101   1/1  plilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildl--------------------
00510561   1/1  ldaltv................................eellalaerllsggkvdlvviDsltalapale
00468951   1/1  dllllpaltveellala................................erllsggkpqlvviDsltalr
00498531   1/1  lpaltveellala................................erllsggkpdlvviDsltalapsll
00487021   1/1  gGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifldadpeell.
00379961   1/1  lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrll-------------------
00434401   1/1  erqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlevalerrlkrlgr-
00477011   1/1  DtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedand..ldtes-------------------
00470731   1/1  gagrtpeqlealldllee..............lgrpvvviilttnrevlldral.rRpgrllldep..el
00405881   1/1  ellsggekqrlalarallgkpvilvlNKiDeptneldlellellee.......lggtvvlvSahdgegld
00368571   1/1  epe....ptldellellselglrdladrleklvagglagllegaektaasilel----------------
00404191   1/1  ...........delvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergv
00451571   1/1  ggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpail-----------------
00513761   1/1  elrallalllaiaralaadeillvddptsgldaetqleilelllelllklg-------------------
00532471   1/1  rippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviylda
00439861   1/1  ..............plglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakel
00499191   1/1  ggqrqrvaia.....dpdvlildgptllldpelr------------------------------------
00513251   1/1  .gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvll
00356411   1/1  lvlNKiDlleekiveellellgleykgd.rdpeelsggqkqrvalaralakdp-----------------
00379261   1/1  ylekrvvsrligappgyvgygl------------------------------------------------
00508671   1/1  ll.vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdl---------------------
00392701   1/1  rqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnrpe
00432181   1/1  pGleefa.sggekqrvalalallreadvlllvvdadeptsfldlellellr-------------------
00406781   1/1  rqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrll-------------------
00480441   1/1  alrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleealell
00498811   1/1  legplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividnd.ls
00469161   1/1  erqrlaidlegalllerlllde------------------------------------------------
00489631   1/1  fdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteee-----------------------
00394721   1/1  glrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlviattnrpellgrleld
00386741   1/1  klrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglllpsgvlv-----
00480251   1/1  agglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaals
00517691   1/1  tidvalarllldgrkilllDtP..Ghed....fvkevlralrladgallvv-------------------
00495771   1/1  ----------------------------------------------------------------------
00482551   1/1  lrrllse..............gkvdlvviDslallarael..ldepllgldarelrellrlLkrlakelg
00515351   1/1  gkvvildglsggllqrvallrallrpdlvifl--------------------------------------
00420941   1/1  rqllalara..akpsilllDEidklapkrsptsald----------------------------------
00461621   1/1  lsggrkqrlalaralavdpe.lild---------------------------------------------
00499331   1/1  ggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryee
00444381   1/1  ...............................................segailsggfkq-----------
00409841   1/1  ........vlldgrdllllDtPGlidfaseptnlldleiieallraleead-------------------
00533151   1/1  pvvildgfpggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrlerylkly
00410321   1/1  ----------------------------------------------------------------------
00437921   1/1  ..............kpdvlllDEidrl.dpdaqnallklleel.pagvtli-------------------
00410531   1/1  rfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiil-------------------
00478081   1/1  efrelleealalladgdvvilDgfgrlldarq..lleelllllleepppdlvifldadpevlleRllkRg
00420081   1/1  ----------------------------------------------------------------------
00367291   1/1  .....lvgegegrlrgalaeal------------------------------------------------
00402371   1/1  rqllglaraa..kpgvlflDEi------------------------------------------------
00401211   1/1  tikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGh......edflkellralaladga
00521551   1/1  glrqllalaraanpgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegl----------------
00437901   1/1  klrellaealteavlkgkpsvl------------------------------------------------
00476071   1/1  glvygvlqdrllerllaagpdv------------------------------------------------
00519581   1/1  ......dleaverhlldiaeellengeil-----------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482721   1/1  ggqgdvliiegalllepgllplpdlvifldap.pevlle-------------------------------
00472911   1/1  agfrqrladlirallakgkvvild..gtglsreareell-------------------------------
00511381   1/1  ............qdpdviliDE.....aqfldpevvevlleladtgilvlvtglemdfagelfegsllL-
00403151   1/1  ----------------------------------------------------------------------
00457851   1/1  legaealreallragplpdlvifldapleelleRllkrgreplddteevilkrlerlrelyerliepye-
00527261   1/1  ........eelgellellkkllkklsellglsilglelilglsgg-------------------------
00478391   1/1  ..........llakgkvvildgtnlsealdealr------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00473941   1/1  sdlrggfkqa........akpg------------------------------------------------
00516041   1/1  vildgtgrlleldealellgpdlvifldappeelleRllkr.....gldeeaieerlerlreilepl---
00416171   1/1  lleselfghekgafgggekq.r------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  leg..gki.vlsarraqlleir------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GRIVLEGPASELKHNARVREAYLGR---------------------------------------------
00475891   1/1  lvlddGrivelgtpeellenpgllaa--------------------------------------------
00379581   1/1  dealrladrilvlddGrivelgtp----------------------------------------------
00378981   1/1  ilvlddGrivelgtp-------------------------------------------------------
00422801   1/1  k.gltvllvth-----------------------------------------------------------
00440861   1/1  pglvvlisaltgegldeltvre------------------------------------------------
00458601   1/1  dealrladrilvlddGriveegt-----------------------------------------------
00500441   1/1  ilvlddGrivelgtp-------------------------------------------------------
00420701   1/1  rilvlddGrivelgt-------------------------------------------------------
00490801   1/1  lellrelakegktvllvtHdlse-----------------------------------------------
00510251   1/1  ellellrelakegktvllvtHdl-----------------------------------------------
00475991   1/1  HdlsealrladrilvlddGriveeg---------------------------------------------
00482201   1/1  ilvlddGrivelgtpeellenpg-----------------------------------------------
00466971   1/1  ladrilvlddGr----------------------------------------------------------
00390411   1/1  keeaekakall-----------------------------------------------------------
00425571   1/1  dGrivelgtpeelle-------------------------------------------------------
00502741   1/1  ddGrivelgtpeellenp----------------------------------------------------
00367901   1/1  lglgg.lldrp-----------------------------------------------------------
00482261   1/1  rilvlddGrivelgtpeellenp-----------------------------------------------
00530591   1/1  lvtHdlseal.ladrilvlddGr-----------------------------------------------
00404101   1/1  rilvlddGrivelgtpeellenpl----------------------------------------------
00361211   1/1  dldlldsallrpg---------------------------------------------------------
00509431   1/1  dglellvglnglldr-------------------------------------------------------
00466931   1/1  SGGerqrvala-----------------------------------------------------------
00498251   1/1  lrlakelgvtvllvthdl----------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00424961   1/1  lDgeivlsllla----------------------------------------------------------
00485931   1/1  ggaalslaleladrilvlgdG-------------------------------------------------
00468691   1/1  r.eilellrellkelgy-----------------------------------------------------
00469451   1/1  ......Asdrvlvlrdgriv--------------------------------------------------
00372301   1/1  alladrvvvlndgriva-----------------------------------------------------
00496111   1/1  dladsgriavladgrivle---------------------------------------------------
00495371   1/1  eeladrvavlaggriv------------------------------------------------------
00468601   1/1  adrilvlgvGeivedgtpfell------------------------------------------------
00379601   1/1  Griveegtpeellan-------------------------------------------------------
00488521   1/1  gvtvllvthdld----------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00448931   1/1  ggadlslaleladrilvlgdGe------------------------------------------------
00485451   1/1  dlreae..adrilvlrkgdive------------------------------------------------
00367481   1/1  dlelaalaadrivvln.grvvadgtp--------------------------------------------
00500611   1/1  dlreveeladkr----------------------------------------------------------
00422141   1/1  yvfqspnlfpl............-----------------------------------------------
00503371   1/1  lellekeleeleel--------------------------------------------------------
00464791   1/1  dal.rei---------------------------------------------------------------
00371631   1/1  edpdvlilDgptalldpltr.e------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00532531   1/1  yvllsGrivesgtte-------------------------------------------------------
00437981   1/1  rcqvirfpplseeelle-----------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00414121   1/1  iDllselt--------------------------------------------------------------
00512891   1/1  grivelgplse-----------------------------------------------------------
00475371   1/1  vldlg-----------------------------------------------------------------
00495031   1/1  thdlrevegrle----------------------------------------------------------
00457311   1/1  grsadrvl....----------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00462761   1/1  drila-----------------------------------------------------------------
00437941   1/1  llsRfdviefpppdeee-----------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00426051   1/1  lar-------------------------------------------------------------------
00489571   1/1  dd......Gtpeellarpanpyvre---------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00493431   1/1  leelldiivvlllglilqp---------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00503741   1/1  rlleegkltdk-----------------------------------------------------------
00464411   1/1  ang.sieevveeilk-------------------------------------------------------
00490731   1/1  eglgvpgvvlNkldlvaeggaalel---------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00496571   1/1  ialyeg----------------------------------------------------------------
00368501   1/1  grelrdgellkalk.eaeaeellel---------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00510561   1/1  lsll------------------------------------------------------------------
00468951   1/1  pal-------------------------------------------------------------------
00498531   1/1  llde------------------------------------------------------------------
00487021   1/1  ..eR..llkRgreserg..epldll---------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00470731   1/1  dppdree---------------------------------------------------------------
00405881   1/1  elldaile--------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00532471   1/1  dpeell...eRllkRgrdpeeq------------------------------------------------
00439861   1/1  gv--------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00513251   1/1  lde-------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00392701   1/1  eld-------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00480441   1/1  laillal---------------------------------------------------------------
00498811   1/1  leevvdr---------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00394721   1/1  pallrrfdvielg---------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00480251   1/1  valilgl---------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00482551   1/1  vtv-------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00499331   1/1  l---------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00533151   1/1  er--------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00478081   1/1  rrer.kddseevlellekrler------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00401211   1/1  llv-------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------