[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39673.1


[Show Plain Result]

## Summary of Sequence Search
   1::441
 208::433  1.2e-49 42.1% 0039797 00397971 1/1   pendent exopeptidases                   
 208::430  8.9e-43 40.9% 0051051 00510511 1/1   pendent exopeptidases                   
   1::441


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRGRDSLSGRANHFVLFRAILACAAALLCAAPTAGVAGEAVATSAPAPTSFPIAAEVRLAGDDTQTRFV
00397971   1/1  ----------------------------------------------------------------------
00510511   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IDLDRTVPMRAFALADPYRVVIDLPQVNFRLPAASGGTGRGLIKAYRYGLVMPGGSRVVLELSGPAKITK
00397971   1/1  ----------------------------------------------------------------------
00510511   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ADMLEAANGQPARMVIELGSVDRTAFVESLGVEKGPELRPAIGAADATSSVPHRVESPKLDAAKDDLRPV
00397971   1/1  -------------------------------------------------------------------gkv
00510511   1/1  -------------------------------------------------------------------gkk


                         -         -         -         +         -         -         -:280
query           IVLDPGHGGIDNGTQSQSGVSEKALVLEFALALRDQMEKGGKYRVVLTRTDDTFIPLNDRVKIARAHSAA
00397971   1/1  ividpGHggkdpGavgllggllEkdvtldialrlaelLeallgaevvltrdddvflslnervalanrlga
00510511   1/1  ividpGHggkdpGavg..gllEkdlnldialklkklLekl.gakvvltreddldlvfvslservalankl


                         -         *         -         -         -         -         +:350
query           LFVSIHADALPRGEGDAQGATIYTLSDKASDAEAQRLADAENKADAIGGVNLTEEPTEVADILIDLAQRE
00397971   1/1  dlfisiHadaaps..gkarGaevyylsg..........................................
00510511   1/1  gadlfvsiHaNaag.....asGaevyyysgsg......................................


                         -         -         -         -         *         -         -:420
query           TKTFSNRFAQTLMREMKSATRLHKQPLKSAGFRVLKAPDVPSVLLELGYVSNKGDLKQLVSEQWRTKTVG
00397971   1/1  ....sslrlaklilkelvkalgllnrgvkranlavlrstdmpavlvElgfisnpedealladpsyqqkla
00510511   1/1  ......kskklaeliqkelvkalglknrgvkqranlyvlrntkmpavlvElgFisnpedaallkdesyqd


                         -         -         +         -         -         -         -:490
query           AVALAIDSFFAKRLVSAGKPD-------------------------------------------------
00397971   1/1  eaiaegileyfgl---------------------------------------------------------
00510511   1/1  klAeaiaegi------------------------------------------------------------