[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39735.1


[Show Plain Result]

## Summary of Sequence Search
   1::351
   7::349  8.5e-62 30.5% 0035444 00354441 1/1    II aaRS and biotin synthetases         
   7::349  6.7e-55 31.0% 0046437 00464371 1/1    II aaRS and biotin synthetases         
  20::345  6.4e-52 30.6% 0046052 00460521 1/1    II aaRS and biotin synthetases         
  14::345  3.7e-51 34.9% 0048309 00483091 1/1    II aaRS and biotin synthetases         
  20::347  5.1e-51 33.3% 0046922 00469221 1/1    II aaRS and biotin synthetases         
  23::353  6.5e-51 31.2% 0046597 00465971 1/1    II aaRS and biotin synthetases         
  13::345  2.7e-46 33.8% 0048394 00483941 1/1    II aaRS and biotin synthetases         
  23::353  2.9e-44 27.8% 0045899 00458991 1/1    II aaRS and biotin synthetases         
  23::342  1.4e-38 32.0% 0050706 00507061 1/1    II aaRS and biotin synthetases         
  10::341  1.7e-34 29.2% 0051519 00515191 1/1    II aaRS and biotin synthetases         
  22::342  9.7e-32 26.2% 0045676 00456761 1/1    II aaRS and biotin synthetases         
  23::343  9.9e-31 29.2% 0048934 00489341 1/1    II aaRS and biotin synthetases         
   8::345  3.2e-21 30.0% 0042520 00425201 1/1    II aaRS and biotin synthetases         
   9::341  1.2e-15 23.2% 0035005 00350051 1/1    II aaRS and biotin synthetases         
  22::156    4e-12 27.6% 0049994 00499941 1/1    II aaRS and biotin synthetases         
   8::341    2e-11 22.9% 0040152 00401521 1/1    II aaRS and biotin synthetases         
   9::200  1.8e-08 23.0% 0042525 00425251 1/1    II aaRS and biotin synthetases         
   6::146  1.3e-05 22.0% 0041426 00414261 1/1    II aaRS and biotin synthetases         
  12::162  0.00023 24.5% 0041634 00416341 1/1    II aaRS and biotin synthetases         
   1::351


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQGGTFASPWWDPARYLDRKPFLRARSAVTRAARDWFAAAEFAEVETAILQLSPGNETHLHAPRTEFKGP
00354441   1/1  ------dletrlryryldlrtndllrailrlrskiiraireffdergflevetPiltssdg.eggarlfl
00464371   1/1  ------slelrlryryldlgrrdllpailrlrskiisaireffeergflevetPiLtkssgeg....vak
00460521   1/1  -------------------llPlpikklvslelrlryryldgrrdllpailrvrskiesaireffdergf
00483091   1/1  -------------lryldgrrdllpailrlrskiisaireffeeygflevetPilepseleg......ak
00469221   1/1  -------------------tlpllldlellpldkklvslelrlryryldgrrdllpailrvrskierair
00465971   1/1  ----------------------aleilvlskaelplypldkklvslelrlryryldlrrdllpailrlrs
00483941   1/1  ------------nrldlgtndllpllrlrskiesaireffdeygflev.tPlilepaedllflrgggarl
00458991   1/1  ----------------------plPlkikgdvelslelrlryryldlrrdllpailrlrskiisairefl
00507061   1/1  ----------------------gmirqlpsGlydwlplglrlrrkiediireffderGflevetPilepa
00515191   1/1  ---------yllPkGlrdllplglrlrskieniireffdkrGflevetPilepaelllrwegaghllvgk
00456761   1/1  ---------------------alklrseviraireffeerlakelgfvevetPilvstelglgdnldgve
00489341   1/1  ----------------------irqlvsGlydllplglrlrrkieniireffeerGflevetPilepael
00425201   1/1  -------kidvllgrrdllpgglhprskvieaireiflslgflevetPilesaesnfdallfpvdhpard
00350051   1/1  --------iiqlpkgtrdllpaglrlrrkieniirevferyGylevetPilepaelllgslggrldhygk
00499941   1/1  ---------------------lglrlrskied.irevfdrygflevetPilepaellgas......dfld
00401521   1/1  -------irqlpkGtrdylplglrlrrkieeiirevfrryGyqevltPilepaelllrsagghwdiygke
00425251   1/1  --------RiyGydnipvtlp.lhplqkllrrlreilaglGftEvitfsllslelahparlmqdtvylln
00414261   1/1  -----eedaeldhvelllrlglldlrlsvsGlydllPlgarlrraieniireeldelgylevltPilvpa
00416341   1/1  -----------dhrelgkrlglidfereagsGlydllPlgarlrrklenfireelvklgyqevltPilvp


                         -         -         *         -         -         -         -:140
query           DGELRTRFLRTSPEFACKKLLAAGEERIFEFARVFRDRERGRLHLPEFTMLEWYRAGEGYQTVIADCAAL
00354441   1/1  vpldyfgkdly...LrqspqlylkrllaggfervyeigpvFRnEdsdarHlpeFtqlelemafadyedlm
00464371   1/1  elftfsdrfgrdlyLrpspelylkrllaggldrvyqigpvFRdErpgarrlrEFtqldaemagadyedlm
00460521   1/1  levetPilepaell....gagkelftfkdrggrdlaLrpspelylarllaggldrvyqigpvFRdErprt
00483091   1/1  elfftdrggrdlyLrpspely.krllaaglgrvyqigpvFRdErpqtgrhlrEFtqldaemagvadledd
00469221   1/1  effdergflevetPiLtkssgeg..agkelfrfkdrgg..relaLrpspelylkrllaagldrvyqigpv
00465971   1/1  kiisairefleergflevetPiLtkssge......gaadlfvkdrlgrdlyLrqspqlylkrllaggfdr
00483941   1/1  dgkel.....drlgrdlyLrpspelylkrllagglgkvyqigpvFRdErpqsgrlrhlpEFtqldaemag
00458991   1/1  eergflevetPilepsel......egaadlfvkdrlgrdlyLrpspelylkrllvggldrvyqigpvFRd
00507061   1/1  ellkesggedifge.mftftdrgg..relaLrPettpqlarklllrsgrdlPlrlyqigpvFRnErpgag
00515191   1/1  elftftdrggrelaLrpeltpqlarlllrsgrdlPlrlyqigpvFRdErpglgRlreFtqldaeifgads
00456761   1/1  kpvlfdlkdyggeelyLrqslql.ykrlllanyglgkgegvytigpvfRaEepqldrrHlreftqldaEl
00489341   1/1  leesaghlldkfakel.ftvtdrggrelaLrpelTaevarlllknllvsgrdlPlrlyqigpvFRnErpr
00425201   1/1  lqdtfylggavakelytfkdyfgrdllLrthttlvlarllasllkPlrvfeigpvFRaErsdathlpeFh
00350051   1/1  emfrlkdrggrelaLrpdltppvarllaqnllsykelplrlyyigpvFRdErpglgrlreftqvdaeifg
00499941   1/1  rsgre..laLrpdltpplarlllmsyrdlplrlyqigpvfRdErpg..rvref.qldaeifgeddlaada
00401521   1/1  .myrfkdrggrelaLrpdltppiarlfaellsyrdlplrlyyigpvFRdErpglgrlreftqldaeifga
00425251   1/1  PlseersvLRtsllpgllralaynlnrglklPirlfeigrvfrndeplvlaghlrgfhqleglvvdkdvd
00414261   1/1  ellekesghlegfgdelfrvtdrggnalgrelaLrptselpltrlfrdeilsyrdlPlrlyqigpvFRnE
00416341   1/1  aelleksghldkfgeemfkltkdregrdlyLrPtaepgitrlfadellsyrdlPlrlyqigtvfRnEasg


                         +         -         -         -         -         *         -:210
query           IALAARTTGIGQFSFRGRTADPQAEPEMLTVAAAFARFAGIDLLATIIGGEGDRDALARAAAAKVRVADD
00354441   1/1  dlleellkyvlkallgnllvelelleidltepfprityaeaiellggdkpdlrldlellll...alakel
00464371   1/1  aeleallrdllkal.lgdlklelnglgidllrplerlgliekllkvlgaldkldrl....gleeaiellr
00460521   1/1  grlrEFtqldaemagadye....elldlleellkalglkife.....irln.pfkrltyaealeilgsds
00483091   1/1  aellelllrllfklglgdfvlelnlrgillgvlglpfprltylealdkll....................
00469221   1/1  FRdErprtgRhrEFtqldaemagadyedldaeleallkellkailg..........idlglpfirityre
00465971   1/1  vyqigpvFRdErprtgrhlrEFtqldaemagaddledlmellelllrllfklvlg.........dltlel
00483941   1/1  adledlmaeleallaellkailgllglelei........fgritlsealeflg.................
00458991   1/1  ErprtgrHlrEFtqldaemagvadledlmelieellkeilkallgdlklelnslgilegileygf.....
00507061   1/1  RlrEFtqldaeifgadeedadaevldllleilkrlglpdfvrlrlntrpilglgsdefdleagealieal
00515191   1/1  edadaevedllleilkelglkyvvvrlsdrgalggllevlgdarealielldklglalliellelgl...
00456761   1/1  vgadsedllaeleelvvdilkalglteklllklfgllkvlpdpfprityeeaidkldklgpkeregellk
00489341   1/1  agRvreFtqleaeifgadsedadaevldllleilkelglpyvvvelgtgdileeflalydvledalrall
00425201   1/1  qlegevagadlslaeliglleellkelf..........................................
00350051   1/1  adsedadaeliallleilkrlglkdvrlelnslgilealleylglllsaefallealdeddivrleavp.
00499941   1/1  eviallleilkelglk------------------------------------------------------
00401521   1/1  dsedadaevlallleilkrlgleddvtlklnhrglleavlaylgllgdllsrlfdvl.............
00425251   1/1  ..fadlkglleallealgl.evrfrpsefpflhpgreadillggleiGgiGelhPevlea----------
00414261   1/1  grptrg----------------------------------------------------------------
00416341   1/1  rgrGLlRvreFtqvdahifgdp------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DNWSDIFSKVLVDHIEPRLGEGRLTVLCEYPAPEAALARTKADDPRVAERFEVYACGVELANGFGELTDA
00354441   1/1  gvkveiklglgdllselferlleeklgd..ptfvtdfPleispfymplpedpglaerfDllvnglElagg
00464371   1/1  elglkvevakelgalllelleelveeklg..hpvfvtdypaelsplymplpldpdllerfDllvrglEly
00460521   1/1  pdlr.....................lledeldrlelldllllelieekllvd.pvfitdypeeisplykl
00483091   1/1  ...lgllveldldlgklldalllrlleeklgsg.pvfltdapalldalyl.lsddpgvaerfdllvrglE
00469221   1/1  aleilledkpdllfdle......................ldlldlldllllelieeelgkllpvfvtdyp
00465971   1/1  nrlgylealleyggvlgadf..lrlt...yeeaidlldknglevldvkdlgllllllleelledklghd.
00483941   1/1  .......................lldelveellelfepvfvtdyp.....lafyapddprlvrgldlytp
00458991   1/1  ................llltyeelielldkldkdslerlelgalllllleelledkllkd.pvfitdypl
00507061   1/1  dklglaanievl........................dalygpklldelldaldelvg...lptflldfpl
00515191   1/1  .................................fvgplliallkdvldrpllvleqaplilldfllp...
00456761   1/1  elga.........................vflrilgrklsdglghpvflpdyplllkpfymkldglngdl
00489341   1/1  ealdlanieglgafylkkldikvedalgllatlntildal..............................
00425201   1/1  ......................................................gelvevrlrppyfpft
00350051   1/1  .....lgildekaegllellellgagsllekl....leealgr..leqlleyl...kalgvpvrldlslv
00499941   1/1  ----------------------------------------------------------------------
00401521   1/1  ...........dklgedrleknllrildfkrggyaevlekaeall.dpllaealeeleallealealgie
00425251   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AEQRLRFTASMDEKERRYGERYPLDEDFLAAVGRMPEASGVALGFDRLVMLAAGAMRIDQVVWTPPADEA
00354441   1/1  sirlhdpellrerfeelgldkeegdleagglyewyldaleyglpphgGfGlGidRlvmlltgldnIrdv-
00464371   1/1  ngsirlhdfelqlerleeqgsilgggrydglgldedlldalgyglpphgGfgiGldRlvmlllgldnir-
00460521   1/1  ldlldalaerfdllvpglelvrgslryydgivlearf......kelglgdveaggryddlldalg-----
00483091   1/1  yytgsirehdlelllerfgaqglgggr.......yd.dllealgyglpphgGfgiGldRlvmlll-----
00469221   1/1  kl.kplymlleddpdllleafdllvnglelvrGslryydgivlearf......kelglgtveaggry---
00465971   1/1  pvfltdypaelkplyklldpldpdlaerfdllvrglElyngsirehdpeelgarfeil......gggrea
00483941   1/1  gtvfElasgslrlhdpeelgarf.......klggggaeryd.dlldalgygelpphaGfgiGldR-----
00458991   1/1  eikpfyllklldapgvaerfdllvrglElyngsirevdpeelgarfe......ilgggee.ryd.dllda
00507061   1/1  plspla.......evlerfelvlaglelaggspelidpslqrgleyytgivfelyakglgag--------
00515191   1/1  erfellvaglellnvgypvlidpslvrgleyytgivfeayagglgaalagggrYd.gllea---------
00456761   1/1  lesfdlllnglelvsglirvtdl.vleaqlkll........gdggrydlglleallygelPp--------
00489341   1/1  .....dfellerlelyvdgleaa.gvpvlldpalvrgldyytgivfelyakalealgleaava-------
00425201   1/1  epsfevfvygyelgdwfevlgcglllpevl............eaaggdydylvallyglpppgvG-----
00350051   1/1  rgldyytgvvFellargigvggaiag......................GgrY...dgllea---------
00499941   1/1  ----------------------------------------------------------------------
00401521   1/1  vvidpglvrgldyytglvFevylpgievgheiagG..........................---------
00425251   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           S---------------------------------------------------------------------
00354441   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00465971   1/1  lly-------------------------------------------------------------------
00483941   1/1  ----------------------------------------------------------------------
00458991   1/1  lgy-------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00456761   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------