[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39945.1


[Show Plain Result]

## Summary of Sequence Search
   1::346
  19::240    2e-40 32.0% 0045717 00457171 1/1   p containing nucleoside triphosphate hy 
  27::257  1.9e-34 33.5% 0052931 00529311 1/1   p containing nucleoside triphosphate hy 
  15::260    2e-23 25.3% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
  15::256  8.6e-23 26.8% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  15::259  4.1e-18 27.5% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
   5::239  8.8e-18 28.8% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  15::259  1.3e-17 26.7% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
   6::239  6.7e-14 25.6% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  11::259  3.5e-11 26.7% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  29::269  1.6e-10 24.9% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
   6::238  1.2e-09 25.4% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  14::226  4.5e-09 23.5% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  15::238  7.4e-09 21.9% 0049053 00490531 1/1   p containing nucleoside triphosphate hy 
  13::214  7.5e-09 23.0% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  12::259  9.7e-09 29.2% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  45::192  3.2e-08 33.8% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  10::226  3.3e-08 25.0% 0040238 00402381 1/1   p containing nucleoside triphosphate hy 
   8::198  3.5e-08 25.5% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  11::205  1.7e-07 26.9% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
   6::238  4.2e-06 26.6% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  20::212  8.8e-06 24.7% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
   8::205    1e-05 25.8% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  23::257  2.7e-05 20.3% 0039713 00397131 1/1   p containing nucleoside triphosphate hy 
  21::207  3.8e-05 25.7% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  42::212  3.8e-05 22.8% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  16::205  6.6e-05 25.2% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  22::198  0.00012 25.4% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
   1::217  0.00014 22.2% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  21::193  0.00017 20.8% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   6::239  0.00089 23.9% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   1::346


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSARKAAADIVAKLPRETTALFGHHVAEQALLDAYRGGRIAHAWLIGGAQGIGKATLAYRMARFVLAHRD
00457171   1/1  ------------------lddivgleeakellleallagrlphalLlyGppGtGKttlakalakellgln
00529311   1/1  --------------------------edlklllrllagrllhalLlyGppGvGKttlaralakallcefi
00476651   1/1  --------------yeplveklrpvllddlvgqeeakeallealaggrpprpvllvGppGtGKTtlaral
00437981   1/1  --------------lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagl
00474201   1/1  --------------deelelleklslllveklrpvllddlvgqeeakeallealragrpgh.vllvGppG
00437921   1/1  ----lglllveklrpkllddvvgqeealerlllalkagklph.lllvGppGvGKTtlaralarlllgs..
00494911   1/1  --------------llveklrpvllddlvgqeeakeallealaagrpgh.vllvGppGtGKTtlaralan
00437941   1/1  -----lrplveklrpknlddvygqeevlkalslalekgrp.ehlllvGppGtGKTtlakalaglllptsg
00473941   1/1  ----------eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagll.
00462581   1/1  ----------------------------edleslllnplvkfedivpkvlddleealealaea.klpppk
00437901   1/1  -----slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGK
00430121   1/1  -------------iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkglelgirpggnvl
00490531   1/1  --------------tlpaleseardltekarpvllddviGqeeaierllealergppgn.vLlvGppGtG
00379961   1/1  ------------yrpvdfddivGqeealralslalaagppeg.vllvGppGtGKstlaralagllppdsg
00386741   1/1  -----------klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagel.
00420081   1/1  --------------------------------------------smkkglrIaleGpsGvGKTTlaklLa
00402381   1/1  ---------PlsklleddlplllklrpdlfddvvgqdeaieallealrrarkglnlglkprgnvlLvGpp
00406781   1/1  -------plveklrpvllddvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlak
00392701   1/1  ----------eklrpvllddvvgqeeakeallealagarlaledlslgirpgknvlLvGppGvGKTtlar
00418301   1/1  -----drplleklrpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtl
00416171   1/1  -------------------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllpr..
00521551   1/1  -------plveklrpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlar
00397131   1/1  ----------------------pmmlyvlqliella.kslapvylllGeegtgkeelaraih........
00394721   1/1  --------------------vvgreealeallealrr.gpprnvlLvGppGvGKTtlakalakelaagsg
00512891   1/1  -----------------------------------------evilltGppGvGKTTlakalagel.....
00367291   1/1  ---------------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtla
00482661   1/1  ---------------------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqy
00402371   1/1  vlektgipltkllrpvllddviGqeealeallealrr.rpgrnvllvGppGvGKTtlaralagllvrssg
00470731   1/1  --------------------arpltfddvvgqdeakeeleel.lagllgikkpkvillvGppGsGKTTla
00368501   1/1  -----kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgk...nvlLvGppGvG


                         -         -         *         -         -         -         -:140
query           PLADAVQGAASLDLDPSHPVVRHVAAEAHGGLLTLERSVNDKGVLRNVITVDESRETIGFFGSTAAVEGW
00457171   1/1  .........flsvslselcskcvgeseglhpdlfllapenspsi.....ifideidallekrsltplegg
00529311   1/1  elnpclecnsc..................................asligiddirelieflslspllgkr
00476651   1/1  anelgrpfvpvallcfvrvncaallelsasdlleselfgee.................keaflgallerl
00437981   1/1  lgpdsgkilldgkdirrgiglvfqliglfphltvlelvalgl..................ggilveevre
00474201   1/1  tGKTtlaralanelprslpglpfvr.vnasdltdvglleellgkllgaat....................
00437921   1/1  .....gggvdvielda.............................sdlrgvddlreligevlqalglllg
00494911   1/1  ellrlgvl......glpfvrvnasellealllsdlfgell.................gallralfellrg
00437941   1/1  .......gvrvlgidaselld...........................pselsggerqrvliaralladp
00473941   1/1  ...gapfielsasdllg...........esdlrggfkqa...............................
00462581   1/1  g.vllyGppGtGKTtlaralakel.....................glpfvrinasdllvgllvgelegrl
00437901   1/1  Ttlakalakel.....................gapvieidaselrd...........vddlsgyvgelsg
00430121   1/1  lvGPpGvGKTtlakalagllfp.........sgvpfirinlseltekllvselighppg.yvGedelgvl
00490531   1/1  KTtlaralakelargd.....................vpevlvgvpvieinassllfGskyvgefeealr
00379961   1/1  ..................rivlvgnlsdlldpkdlrellragiplvflnfaalpasllesellsggerqr
00386741   1/1  ....................gapfvrldaselsg.......................geklrgllarala
00420081   1/1  rhlgptggrvllvgEPiay................wrsvggsdlleliyqlplrldlgeislddaallll
00402381   1/1  GtGKTtlaralakal.....................gvpfvrinlselteallvsdl....iGhldgyvg
00406781   1/1  alagel............gvpfvrisase..........................llgkyvgelsgglrq
00392701   1/1  alagll............gapfgrvdasd..........................llg.kyvgelsgglr
00418301   1/1  aralakll..gr...............................................pfirvdaselt
00416171   1/1  ................sgvpfvrvncsaltedllesel....fghekgafgggekq.rlgllrla....d
00521551   1/1  alagll............gapfvrlsas..........................elvg.kyvgelegglr
00397131   1/1  ........................caaipeglleselfgvekg........adtgallekagllslfadg
00394721   1/1  pilldgvpv............................................vrldlsellsvsdlvge
00512891   1/1  ...gakfgsvsltgrdvrsarrgigyvfqtveellgllaelvglevrgeleellktlikelsggekqrva
00367291   1/1  ralanel............gapfirvdaselleklvg...........................egegrl
00482661   1/1  allakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlf
00402371   1/1  pilldgvpf..................................vrldasellefgkyvgafegglrqllg
00470731   1/1  ralakel............gagfilid.gddlrekavgeleklgrdlfqvaregglvpdilfideidall
00368501   1/1  KTtlaralakll............gapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg


                         +         -         -         -         -         *         -:210
query           RVCIVDTVDDLNASSANALLKVIEEPPQRSLFLLISNSPARVLPTIQSRCRKLMLRPLATADVIAAAVAA
00457171   1/1  rkvviideadrlteeaanaLlktleeppsnvlvilttnrperldpallsRcrvielplpdeeerleiLle
00529311   1/1  kvliideadrlnkeaqnaLLktLEeppgntifilatnnpskllptilSRcqvfrlkpleeileilkrile
00476651   1/1  gklalagggtvlflDEidkldpdvqnaLlrlleeppsnvrvilttnrpekldpallsRflvielpppsle
00437981   1/1  llkellsgGqkqrvaiaralagdpkvlllDEptaldpdaqnaLlklleelakgvtvilathdlsellpal
00474201   1/1  ...............fllakpgvlflDEidkldpdvqnaLlrlleelpsnvrviattnrpleldpallsR
00437921   1/1  gkpdvlllDEidrldpdaqnallklleelpagvtlilttnrleellpallsrfdiiefkplseeelleil
00494911   1/1  alelakggvlflDEidrlspdvqnaLlrlleelpsnvrviattnrpelldpallsRflvielpppsleer
00437941   1/1  kvlllDEidaldpeaqnaLlklleelpkgvtvilttnrleeldpallsRfdviefpppdeeelleilkli
00473941   1/1  .akpgvlflDEidrldrevqnaLlelleelqvtilggglvvvelllllpsgvlviaatnrpelldpalls
00462581   1/1  rglfteav.................lanpgvlflDEidrlplkrqaggdllrallealltlldglislps
00437901   1/1  geklrellaealteavlkgkpsvlllDEidaldpdvlnallklldglrdlsgvliilttndpeeldpall
00430121   1/1  feaark................appsvlllDEidkldpdvlnaLlqlleegevtdlggrvvdlsnvivia
00490531   1/1  ........rlfgeaekanggviLflDEidklagargsggspdvqnaLlrlle..rgnvrvIaatnrpell
00379961   1/1  valaralalrpGllvlAdggvlllDEpdaldpevqaaLlrlleegevtieragitlllpagvtviaatnd
00386741   1/1  ..kpgvlllDEidaldpdvqeallelleegeltivgggllteldglllpsgvlviattnrpelldpalls
00420081   1/1  slqllfaapylslnevi..daarvlladefikplpagykvviiDRhplsall------------------
00402381   1/1  ededgiltgalrkap....ggvlflDEidkldpdvlnaLlqvleegeltdlggrivdlpnvrviaatnpg
00406781   1/1  rlalara.adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvt------------
00392701   1/1  qrlarallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnr-----
00418301   1/1  eaelvGyesgarlrelfaragigllaladpgvlflDEidkllpargssggdvsredvlnaLlrlleegel
00416171   1/1  ggvlflDEidkldpdvqnaLlrvleegeltrlgggivlpadvrliaatnpdllelvlegelrpaLldRfd
00521551   1/1  qllalaraanpgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledlsnvlviaatnr-----
00397131   1/1  gtlfldeigelpglelqkaLlrlleelpvdvrlilatnrldklveagkfrkdlyyrlvvvplklpplrer
00394721   1/1  legglrglltealalakpsvlflDEidrlldardsesslevlnaLlrlledg..nvlviattnrpel---
00512891   1/1  larallakpdvlllDEidgldpdvleallelleelkrsgvtvilttndldel.eladriallrrgrivel
00367291   1/1  rgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlrlleelrvlsgvlviattnrpe-----
00482661   1/1  ddlvgqeeakeallenlklflkgpellldlglpkgrgllLyGPpGtGKTtlakalane------------
00402371   1/1  laraakpgvlflDEidsllgarggsgvdpevqnaLlrlleeg..nvrviaatnrpelvklgeldpallrR
00470731   1/1  .........rkgpdvildgag.rtpeqlealldlleelgrpvvviilttnrev-----------------
00368501   1/1  .tvlenlalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasvi


                         -         -         -         +         -         -         -:280
query           TDLAPGDPKLADAAAASEGSVSRALTLLGGDALTLHQKTTALLDSLPNVDPRALHALGESIGGTDRATLA
00457171   1/1  klpldddv..lealaeltegspgdalalle----------------------------------------
00529311   1/1  kenielddealellarlsdgdlrdallllllalllllllllllllll-----------------------
00476651   1/1  erleilkllleklglplsdealealaelsggnprellnlleralllalee--------------------
00437981   1/1  lsrcqvirfpplseeelleildrilvleggklvedgaleelaelsg------------------------
00474201   1/1  flvielpppdleerleilkllleklglelsdealealaelspg.nprel---------------------
00437921   1/1  krileeegvklsdealealaelsggdpra-----------------------------------------
00494911   1/1  leilkllleklglelsdealealaelspgnprellnlleraallalleg---------------------
00437941   1/1  lkkeglklddealellaelsggsprdaln-----------------------------------------
00473941   1/1  Rfdlvielpppdleerleilkrllkkegvelddealellaelaggsard---------------------
00462581   1/1  nvrviaatnrpeeldpasllrRfdviielplpldleerleilkll.lelsdealealar-----------
00437901   1/1  rRfdiiefpppdeeelleilkrilekeg------------------------------------------
00430121   1/1  ttnpglegivellldl------------------------------------------------------
00490531   1/1  kfeldpallrRflvielpppdleerlei------------------------------------------
00379961   1/1  dlge------------------------------------------------------------------
00386741   1/1  Rfdlvielpppdeeerleilkrllkkeglelddealealaelaegsprd---------------------
00420081   1/1  ----------------------------------------------------------------------
00402381   1/1  leelvklllgflaell------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00418301   1/1  tilgggvdlpnvlviaatnpdlyrpdel------------------------------------------
00416171   1/1  vi--------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00397131   1/1  pewikllaklf..gleldddalelLasywegNlraleneleklalla-----------------------
00394721   1/1  ----------------------------------------------------------------------
00512891   1/1  gp--------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00402371   1/1  fdvielp---------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00368501   1/1  allgggrelrdgellkalkeaeaeellel-----------------------------------------


                         -         *         -         -         -         -         +:350
query           AFVDGVDRWIAQRLRAGDANANLPRLARLAEVWEKIGRAARDTEAYNLERKPLVFSVFGLLAEAVR----
00457171   1/1  ----------------------------------------------------------------------
00529311   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00397131   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------