[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE39967.1


[Show Plain Result]

## Summary of Sequence Search
   1::139
  84::129  7.3e-10 45.7% 0047212 00472121 1/1   histone-like proteins                   
   1::139


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNRNRSADLIPSRWEGAVKDIDPDAMTVDELWEIHERISQVLCSKIQSEQRKLDGHLSRLRLGVTSGANQ
00472121   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QSDDESGPKPARRPYPKVYPKYRSLKDPSLTWAGRGKQPLWLIDELKSGKSIDDFLIRAKPSNVRKKRR-
00472121   1/1  -------------krakvkakYrdpegegetWsGrGrlPkwlkealeaaGksledflie-----------