[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE40026.1


[Show Plain Result]

## Summary of Sequence Search
   1::339
  63::198  1.6e-19 31.5% 0048676 00486761 1/1   ry domain-like                          
  63::203  5.5e-06 24.8% 0048581 00485811 1/1   ry domain-like                          
   1::339


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSMSVTSEVSQRPRPLTGLRVGLITALVLSLLFGAMIAITFSMQNEVIAHDRDNQMGAISQAITAALDQA
00486761   1/1  --------------------------------------------------------------leqlidel
00485811   1/1  --------------------------------------------------------------lelledel


                         -         -         *         -         -         -         -:140
query           GRFALTQAETTARQAAVARALAAGDRAALSELAGGTYAYLKTQGVPVFGFHAADMTYLLRLHLPDKFGDD
00486761   1/1  lqralavarllaaspaviealeagdrealqelleelrklt...gadyivvtdangirlah.pdperiGdr
00485811   1/1  geralavarllannplvieallsgdpsdalqalaeelrkatgadfivvt.....drdgirlahsdperiG


                         +         -         -         -         -         *         -:210
query           LTKIRPMVLAANKTGRSQVGLEIGIAGTFVRGIAVVRDGDRFVGTVETGLNLEPILEQVKALTNADIAVV
00486761   1/1  ls..ggdvvealltgesyvgiaegsggpslrayaPifdadgkviGvvsvgislesleq------------
00485811   1/1  kpls..gedikkal.nGeeyvsealgtlgpslrafvPiyddngkviGvvsvGislssvdelll-------


                         -         -         -         +         -         -         -:280
query           LSQSLADLPPRGASQNGAGETFGDLMALASTDTQLFNGLLRDGAIRLTRTRDVSAHQLQGGSAAVLVQPL
00486761   1/1  ----------------------------------------------------------------------
00485811   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IDFSGRMIGNIAAVKTFPAHGAALQRTRTELIAAAMIGAILAFVAFSVLARMIAMRGQS-----------
00486761   1/1  ----------------------------------------------------------------------
00485811   1/1  ----------------------------------------------------------------------