[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE40040.1


[Show Plain Result]

## Summary of Sequence Search
   1::344
  26::345 6.5e-106 40.2% 0036596 00365961 1/1   in diphosphate-binding fold (THDP-bindi 
  23::345 4.5e-103 38.9% 0044439 00444391 1/1   in diphosphate-binding fold (THDP-bindi 
  23::345 1.2e-102 41.4% 0041402 00414021 1/1   in diphosphate-binding fold (THDP-bindi 
  27::345 2.1e-100 38.6% 0050394 00503941 1/1   in diphosphate-binding fold (THDP-bindi 
  24::344  5.3e-95 38.9% 0049028 00490281 1/1   in diphosphate-binding fold (THDP-bindi 
  34::343  5.8e-84 37.2% 0049136 00491361 1/1   in diphosphate-binding fold (THDP-bindi 
  34::337  1.4e-77 34.1% 0042762 00427621 1/1   in diphosphate-binding fold (THDP-bindi 
  31::334  3.5e-77 33.8% 0044101 00441011 1/1   in diphosphate-binding fold (THDP-bindi 
  30::334    8e-75 31.3% 0039197 00391971 1/1   in diphosphate-binding fold (THDP-bindi 
  66::344  3.1e-40 26.0% 0045858 00458581 1/1   in diphosphate-binding fold (THDP-bindi 
  94::278  3.9e-37 26.0% 0042488 00424881 1/1   in diphosphate-binding fold (THDP-bindi 
  56::263  3.3e-34 30.2% 0048897 00488971 1/1   in diphosphate-binding fold (THDP-bindi 
 100::288  1.2e-32 27.7% 0051271 00512711 1/1   in diphosphate-binding fold (THDP-bindi 
 106::289  4.9e-29 28.1% 0045130 00451301 1/1   in diphosphate-binding fold (THDP-bindi 
 116::269  1.3e-27 34.0% 0052104 00521041 1/1   in diphosphate-binding fold (THDP-bindi 
 119::331  1.8e-27 21.0% 0040412 00404121 1/1   in diphosphate-binding fold (THDP-bindi 
  94::283  2.6e-25 23.2% 0042045 00420451 1/1   in diphosphate-binding fold (THDP-bindi 
  94::280  6.4e-22 28.2% 0049968 00499681 1/1   in diphosphate-binding fold (THDP-bindi 
  91::305  2.8e-18 24.4% 0041167 00411671 1/1   in diphosphate-binding fold (THDP-bindi 
  92::303  2.2e-16 22.9% 0042411 00424111 1/1   in diphosphate-binding fold (THDP-bindi 
  63::279  2.2e-15 24.2% 0042102 00421021 1/1   in diphosphate-binding fold (THDP-bindi 
 133::303  9.8e-13 25.3% 0052450 00524501 1/1   in diphosphate-binding fold (THDP-bindi 
   1::344


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAAPKKSAAKETGQDRNSGPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQE
00365961   1/1  -------------------------alrrllidallkavsghpghllglagivevlfalhlvfdppnpdw
00444391   1/1  ----------------------pprpelsdeellqlyrhmlltrrfeefllllqrqgkr.gffvlsaGhe
00414021   1/1  ----------------------gvveltvelirvldldgllwlksgheglsldvllqlyrhmlltrrfee
00503941   1/1  --------------------------reildllektycgsigvelmhildllgriwlpedleklskeell
00490281   1/1  -----------------------relvpldlylglteadldrefdlggllglelltlreilallkktycg
00491361   1/1  ---------------------------------LlelyrlalliRrlaldavklangGhlgsflglaell
00427621   1/1  ---------------------------------eelyrlalliRrlaldavelangGhlggslgaaelfv
00441011   1/1  ------------------------------edllelyrlalliRrlaldavsla....ngGhlglylgla
00391971   1/1  -----------------------------kldllqlyrlanliRrlaldavslangGhp.gsplgaagle
00458581   1/1  -----------------------------------------------------------------vkenl
00424881   1/1  ----------------------------------------------------------------------
00488971   1/1  -------------------------------------------------------rpgllghlglglgpe
00512711   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00521041   1/1  ----------------------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00499681   1/1  ----------------------------------------------------------------------
00411671   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00421021   1/1  --------------------------------------------------------------lcpglgpq
00524501   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTGRRGGYSKGKGGSMHMFSMEKHFYGGHGI
00365961   1/1  lsrdvllqlyrhmlltrrfeefltllqrqgki.grfvlsaGhealalyaalalrgydvifptYRdhglll
00444391   1/1  alavgaalalrggedvigmayRgrlnvlalgvplleifaellgklpghpgggdvkmhlgseslgvlfntg
00414021   1/1  fltllqpggkirgffilseGhealavglalalrgedvlgmayRgrlnvlalgvplkeilaellglrtgls
00503941   1/1  elyrlmllareleellldlvrqgki.ghlgsslGqealavllaaalrprdrivlgHrghllylllgldll
00490281   1/1  sigveymhildlegrwllerleslspeellellrlmlliralelrlvllagsgrg.ghllslagqeallv
00491361   1/1  valyrgfeavdvgspaaldrddfvlsvGHgsyrlyalllltGrdls..leellgfrqlgglsgghpesgh
00427621   1/1  alyagfeavnvgapaalnrddfvlsvghgspllyahllltGrd...lsaellgnfrqlgsglpghphrge
00441011   1/1  elaaalfavlrydpdnilwtyrdrfvlsaGhgspllyallyltGrdlsledlktfrqlgsglpghpepet
00391971   1/1  avlvgvflaldpddpvwpnrdrfvlsvghgspllyallyltGrldlsledlktfrqlgsglsghperget
00458581   1/1  ldlltvkgsqllqpllefsGacagcgetpylklltqlfgdrllianatGcssiyggslpttpytlnadgr
00424881   1/1  -----------------------lggplgpaevlralaellpddaivvtdvGtsqfwaarlllpkprsll
00488971   1/1  avlvalaaalpeddivvsdvgchqrwaarlltgrg........................prtllnsglgs
00512711   1/1  -----------------------------eplgpaevlralaealpedaivvsdvGcsqrwaaryltlrr
00451301   1/1  -----------------------------------alaellpddaivvtdvGssqfw.arylrlprprrf
00521041   1/1  ---------------------------------------------gcsqrwgarllgfpeprtflvsggl
00404121   1/1  ------------------------------------------------sglpghpepglmtpgvefttGs
00420451   1/1  -----------------------dgdpltpayvlkalsellpddaivvtdvglsqfwa.rylrfpgprtf
00499681   1/1  -----------------------pprlcpglgpaavlralskalpelglledaivvsdvgcsqrwaaryl
00411671   1/1  --------------------plrpplldpglgpqyvlkalsealpelpddaivvsdvGcsqfwaarylrl
00424111   1/1  ---------------------sdgpplgpq.yvllalsealpedaivvsdvgtsqlwgarllrlrgprtf
00421021   1/1  evlaalsealpedaivvsdvGcsqlwaarylrlrg.......................prtfltsgglgt
00524501   1/1  --------------------------------------------------------------ltsgglgt


                         +         -         -         -         -         *         -:210
query           VGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGTSVTRS
00365961   1/1  algvdllkifrelggklpghpeggggsmhlgsetpgvepttgplGtglpaAvGaAlAaklagpdrvvval
00444391   1/1  hlgtglpvAvGaAlAakllgkdrvvvaliGDGalseGvvhealnlaallglpvlfvvvNNqigistpvgr
00414021   1/1  kgggvpmhlgsp..gllgntghlgtglpvAvGaalAakllgkdrvvvaliGDGalseGvvhEalnlaaly
00503941   1/1  kifrelggk....sgghpvsehlg.....vlfntghlgtglpvAvGmAlAlkllgkdvvvvaliGDGals
00490281   1/1  alalalnpedpvigdhRdrlvllghgspllyaflelrgkledlsggrdgsyhpghpelgvefttghlgtg
00491361   1/1  t....pgvefttgplGtglpvAvGaAlalkllgelfnrglldlvdrvvvaliGDGalseGvvweAlnlag
00427621   1/1  tp.gvefttgplGqglslAvGmAlaakllgalfnrplldlvdrvvvafiGDGalseGvfhEalnlAgvlk
00441011   1/1  pgvefttGplGqglsaAvGaAlalkllgalfnrglldlpdrvvvafiGDGalseGvshealnlaghlklg
00391971   1/1  pgvefttGplGqglpaAvGaAlaakllgalfnrplldlpdrvvvaliGDGalneGvslealnlAghlkld
00458581   1/1  gPawanslfedaaefglghrlcpgcgrfailrlllkal.relgldlllaelpgklvgvstgi.cssrlpp
00424881   1/1  tsgglgsmGyglpaAlGaalalkllgpdrrvvalvGDGsf..gmtlqelataaryglpviivvlnNggyg
00488971   1/1  mGyglpaAlGaalaap....drrvvaviGDGsflmg..leelntaarynlpvvivvlnNggygitrglqe
00512711   1/1  prtfllsgglgtmGyglpaAlGaalalp....drrvvaviGDGsflmg..leelntaarynlpvlivvln
00451301   1/1  ltsgglgtmGyglpaAlGaalaap....drrvvaivGDGsfqmg..lqelataaryklpviivvlnNngy
00521041   1/1  gimGyglpaAlGaala.....pdrrvvaiiGDGsf.qmglqe.lstaarlklpvlivvlnNggygitggq
00404121   1/1  lGqglsaAvGmAlalkylgarfnkdivdrrvyaliGDGeldeGvswealslaghlkldnlivilddNgis
00420451   1/1  ltsgglgtmGyglpaAlGaalanp....drrvvaivGDGsf..gmtlqelataaryglpviivvlnNggy
00499681   1/1  rfdkprtfltsgglgsmGyglpaAlGaalanp....drrvvaiiGDGsflmg..lqelataaryklpvli
00411671   1/1  rrprsfltsgglgtmGyglpaAlGaalarp....drrvvaiiGDGsflmg..lqelatavrynlpviivv
00424111   1/1  ltsgglgtmGyglpaAlGaalanp....drrVvaivGDGsfqmg..lqelatavrynlpviivvlnNngy
00421021   1/1  mGyglpaAlGaalanp....drrvvaiiGDGsflmg..lqelatavrynlpviivvlnNggygmtrgqqe
00524501   1/1  mGyglpaAlGaklanp....drrvvaivGDGsfqmg..lqelatavrynlpviivvlnNggygmirqqqe


                         -         -         -         +         -         -         -:280
query           SAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTRE
00365961   1/1  iGDGalseGmvhEalnlagllklpvlfvvenNgyaistptglatasedlaaraeayGipgirVdGndvea
00444391   1/1  qrstpdladraeafgipgirVdGnDveavyaalkeaveraragggPvlieavtyRgkghseaddpskyrg
00414021   1/1  klpvlfvvvnNqigistpverssayptl..laeafgipgirVdGndveavyaalkealeyarkgggPvli
00503941   1/1  eGvvhEAlnlAgllklpvlfvvedNgigistpvgrsrssedladraeafgipvirVdGhdveavyaalke
00490281   1/1  lpvAvGmalalkllgpdrvvvaviGDGalseGvvhEAlnlagllklpvlivvvdNgigistpvdlrssay
00491361   1/1  llklpnlifivdnNgysisgpvsral.sedladrfeayGwpvirvidGnlDveavyaalkealer...gg
00427621   1/1  ldnlifvvdnNgysisgpvggqt.ledlaarfeayGwnvirvvdGhDvlavyaalkeaker...gggPtl
00441011   1/1  nlifildnNgysisgpvglas.ledlakrfeayGwnvirviwdGhdveavyaalkeaker...gggPtlI
00391971   1/1  nlivivdnNgysidgpvglql.ledlakrfeayGwnvirvdGhsldveavyaalkeaker...gdgPtli
00458581   1/1  yl......nsllgtlhgralgvalglklagpdlvvvvigGDGdaydiG..fealnhaarrnlnvvvlvlD
00424881   1/1  iirqlqeltyggrdlpnpdfaklaeafGakgvltvrvedveeleaalkeale..ragdgpvlievvtd--
00488971   1/1  ltggeglsgtdlpnpdfaklaeafGakgvrvdgpd......eleealeealag-----------------
00512711   1/1  NggygitgglqslttgygysgttlptgllllgllpdfaklaeafGapgvrvdgpd......eleealeea
00451301   1/1  giirglqelfyndlpnpdfaklaeafGanyvaridghkgvrvdtpdel......eealkealaksdgpvl
00521041   1/1  eraggrpsgtdlpppdfaalaeafGapgvrvdgpd......eleealeealagdgpvli-----------
00404121   1/1  idgpvglalklledlekrfeaygwnvirviwgslwdallagddlglllqlmaetldgayqllkalkgayv
00420451   1/1  gitrqqqsltypgndlpnpdfaklaeafGakyvalgirvetpd......eleealkealaadgpvlievl
00499681   1/1  vvlnNggygitgqlqettaggrysttdllgnpdfaklaeafGakgvrvddpeel......eealkealas
00411671   1/1  lnNggygmtrgqqsltygggasgtdl.pnpdfaklaeafGakgvrvedpeel......eealkealaadg
00424111   1/1  givrgqqeltygerlsgtdlpnpdfaklaeafGakgvrvd..dpeeleealkealai..grdgpvlievl
00421021   1/1  ltgggrygtdlpnpdfaalaeafGakgvrvd..dpeeleealkeala....adgpvlievlvdpgtgvl-
00524501   1/1  ltggdrygtdlpnpdfaklaeafGakgvrve..dpeeleaalkealaaak.gdgpvlievlvdpeenvpp


                         -         *         -         -         -         -         +:350
query           EVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQNDPEPDPSELYTDVYR------
00365961   1/1  lyaalkealerarsgggPvlIevvtyrgkghstaddpskyhgkpevdeerahrdpilrlrkylle-----
00444391   1/1  keeveiwk.kkdpilrlrkylieegllseeeleelleevraeveeaveeaealpkpdleelfddv-----
00414021   1/1  evvtyrgkghseaddpskyrpveeyeeirkhrdpilrlakylieegllteeeleeilkevreeve-----
00503941   1/1  akeyaregggPvlieavtyrgkghseadddpskyhgkeeveiekk.rdpierfakylleegllte-----
00490281   1/1  edlaarfeayGipvirvdGhDpeavyaalkeAleyarkgggPvlIeaktyrgkGhseaddptky------
00491361   1/1  gPvlieaktyrgkghseeddpkahrvpldkeeiealr.erdpllrlaeflipeglldeaeelk-------
00427621   1/1  IeakTykgkglplaegtlkaHgvpldpeeyralkevlgwplepdpiprlrkyllelg-------------
00441011   1/1  eakTykgkghsleddakaHgvylgkeevealrkrlglppedlflvpddpiarlr----------------
00391971   1/1  eakTykgkghppaegttkaHgvylgkeevealrkrlglptgeflvpdpilrlyk----------------
00458581   1/1  NevYgnTGgQyspstplgavtkttpaGkierkkdlaalalayGapyVarvsdgadvlqll....------
00424881   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00512711   1/1  laadgpvl--------------------------------------------------------------
00451301   1/1  ievvtdrgd-------------------------------------------------------------
00521041   1/1  ----------------------------------------------------------------------
00404121   1/1  rellfeelgelkelvedlsdeliyllprdGhdleaiyaalkeakes...kg-------------------
00420451   1/1  tdk-------------------------------------------------------------------
00499681   1/1  ----------------------------------------------------------------------
00411671   1/1  pvlievltdpgegvlplvplgkal.---------------------------------------------
00424111   1/1  vdpgegvpplvplgdlavdmvll-----------------------------------------------
00421021   1/1  ----------------------------------------------------------------------
00524501   1/1  lvplgkvlvallsllelvlaave-----------------------------------------------