[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rpal2:ABE40088.1


[Show Plain Result]

## Summary of Sequence Search
   1::217
  29::104  5.4e-12 25.0% 0052655 00526551 1/1   domain-like                             
  25::105  2.5e-11 24.7% 0049195 00491951 1/1   domain-like                             
  30::106  2.8e-11 26.0% 0052885 00528851 1/1   domain-like                             
  31::101  9.6e-11 25.4% 0049910 00499101 1/1   domain-like                             
  24::106  1.2e-10 25.6% 0049523 00495231 1/1   domain-like                             
  32::105  1.2e-10 25.7% 0052848 00528481 1/1   domain-like                             
  30::97   2.8e-10 25.0% 0053096 00530961 1/1   domain-like                             
  32::106  3.3e-10 28.0% 0052647 00526471 1/1   domain-like                             
  35::106  3.3e-10 25.0% 0050188 00501881 1/1   domain-like                             
  36::104  3.3e-10 27.5% 0053065 00530651 1/1   domain-like                             
  36::105  3.4e-10 25.7% 0052877 00528771 1/1   domain-like                             
  40::104  3.7e-10 27.7% 0053202 00532021 1/1   domain-like                             
  35::105  4.6e-10 25.4% 0047677 00476771 1/1   domain-like                             
  32::104  6.7e-10 27.4% 0052798 00527981 1/1   domain-like                             
  32::103  7.6e-10 23.6% 0048725 00487251 1/1   domain-like                             
  32::100    9e-10 23.2% 0052742 00527421 1/1   domain-like                             
  34::105  9.3e-10 23.6% 0052830 00528301 1/1   domain-like                             
  32::105  9.6e-10 23.0% 0050079 00500791 1/1   domain-like                             
  33::104    1e-09 25.0% 0051585 00515851 1/1   domain-like                             
  33::105  1.8e-09 24.7% 0049545 00495451 1/1   domain-like                             
  35::103  1.9e-09 26.1% 0053204 00532041 1/1   domain-like                             
  32::98   2.2e-09 28.4% 0052845 00528451 1/1   domain-like                             
  33::106  2.5e-09 27.0% 0051514 00515141 1/1   domain-like                             
  34::105  3.3e-09 23.6% 0049392 00493921 1/1   domain-like                             
  34::100  3.5e-09 26.9% 0051466 00514661 1/1   domain-like                             
  35::101  5.3e-09 26.2% 0052843 00528431 1/1   domain-like                             
  33::98   7.9e-09 25.8% 0053235 00532351 1/1   domain-like                             
  33::98   1.5e-08 25.8% 0045724 00457241 1/1   domain-like                             
  34::101  1.7e-08 23.5% 0052393 00523931 1/1   domain-like                             
 104::213  0.00052 20.0% 0052886 00528861 1/1   cyclin repressor-like, C-terminal domai 
   1::217


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAARCTLRPRFWPQASIAKSCGSESDTRMPRPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRA
00526551   1/1  ----------------------------rdrrreetrerildaalelfaekgyegtsvrdiakaagvskg
00491951   1/1  ------------------------lmrrrrrrreetrerildaalelfaekGyegtsvrdiakaagvskg
00528851   1/1  -----------------------------rrrkeetrerildaalelfaekGyaatslrdiaeeagvskg
00499101   1/1  ------------------------------rrreetrerildaalelfaekgyegtsvrdiakaagvskg
00495231   1/1  -----------------------llrrrrrrrreetrerildaAlelfaekGy.gtslrdiaaaagvskg
00528481   1/1  -------------------------------rreetrerildaalelfaekGyegtslrdiakaagvskg
00530961   1/1  -----------------------------grrreetreaildaalelfaekgydatslreiakragvskg
00526471   1/1  -------------------------------rkeetrerildaalelfaekGyegtslrdiakaagvskg
00501881   1/1  ----------------------------------etrerildaalelfaekgyegtsvrdiakaagvskg
00530651   1/1  -----------------------------------trerildaalelfaekGyegtslrdiakaagvskg
00528771   1/1  -----------------------------------trerildaalelfaekGyegtslrdiaeaagvskg
00532021   1/1  ---------------------------------------ildaAlelfaekGyegtslrdiaeaagvskg
00476771   1/1  ----------------------------------etrerildaalelfaekGyegtslrdiakaagvskg
00527981   1/1  -------------------------------kkeetrerildaAlelfaekGyegtslrdiakaagvskg
00487251   1/1  -------------------------------rreetrerildaalelfaekGyegtslrdiaeaagvskg
00527421   1/1  -------------------------------rseetreaildaalelfaekgyeattvrdiaeragvskg
00528301   1/1  ---------------------------------eetrerildaalelfaekgyegtsvrdiaeaagvskg
00500791   1/1  -------------------------------kreetrerildaalelfaekGyegtslrdiaeaagvskg
00515851   1/1  --------------------------------reltrerileaalelfaekGyeavtlrdiaeaagvskg
00495451   1/1  --------------------------------leetrerildaalelfaekgyegtsvrdiakaagvskg
00532041   1/1  ----------------------------------etrerildaalelfaekgyegtslrdiakaagvskg
00528451   1/1  -------------------------------kkeltrerildaalelfaekGyeavtlrdiaeeagvskg
00515141   1/1  --------------------------------keetrerildaalelfaekGyegtslrdiakaagvskg
00493921   1/1  ---------------------------------eetrerildaAlelfaekGyegtslrdiakeagvskg
00514661   1/1  ---------------------------------eetreaildaalelfaekegyeglslrdiakeagvsk
00528431   1/1  ----------------------------------ltrerileaAlelfaekGy..lslrdiakeagvskg
00532351   1/1  --------------------------------leltrerildaalelfaekgyegtslrdiaeaagvskg
00457241   1/1  --------------------------------leltrerildaalelfaekgyegtslrdiaeaagvskg
00523931   1/1  ---------------------------------eetrerildaalelfaekGyagtslrdiaaeagvskg
00528861   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ALIQRFTDKATLQRRIMERMTQEVRDYFDAAPSHTGLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGDTQE
00526551   1/1  tlyrhFgsKedLllallerllerllelllealdd------------------------------------
00491951   1/1  tlyryFgsKedLllallerllerllelleealddl-----------------------------------
00528851   1/1  tlyryFgskeeLllallerllerllaaleaalddld----------------------------------
00499101   1/1  tlyrhFgskedLllallerllerllelleel---------------------------------------
00495231   1/1  tlyyyFgsKedLllavlerllerllaalaaaladld----------------------------------
00528481   1/1  tlyrhFpsKedLllallerllerllelllealddp-----------------------------------
00530961   1/1  tlyrhFgskedLllallerllerllel-------------------------------------------
00526471   1/1  tlyrhFgsKedLllallerllerllaaleaaladld----------------------------------
00501881   1/1  tlyryFgskedLllallerllerllelllealddld----------------------------------
00530651   1/1  tlyryFgsKedLllallerllerllelllealdd------------------------------------
00528771   1/1  tlyrhFgskedLllallerllerllelllealddl-----------------------------------
00532021   1/1  tlyryFgsKedLllallerllerllelllealdd------------------------------------
00476771   1/1  tlyyhFgsKedLllallerllerllelllellddp-----------------------------------
00527981   1/1  tlyyyFgsKedLllavlerllerllelllealdd------------------------------------
00487251   1/1  tlyryFgsKedLllallerllerllelllelld-------------------------------------
00527421   1/1  tlyryFpskedLllallerllerllellee----------------------------------------
00528301   1/1  tlyrhFgskedLllallerllerllelllealddl-----------------------------------
00500791   1/1  tlyyhFpsKeaLllallerllerllelllellddd-----------------------------------
00515851   1/1  tlYrhFkskedLllallerllerllelleealed------------------------------------
00495451   1/1  tlyryFpsKedLllallerllerllelllealddl-----------------------------------
00532041   1/1  tlyrhFgskedLllallerllerllelleelld-------------------------------------
00528451   1/1  tlyryFgskeeLllallerlleellell------------------------------------------
00515141   1/1  tlyryFgskedLllallerllerllelllealddld----------------------------------
00493921   1/1  tlyryFpsgKedLllallerllerllelllelldd-----------------------------------
00514661   1/1  gtlyryFkskedLllallerlleellelle----------------------------------------
00528431   1/1  slyrhfkskeaLllallerlleellelleei---------------------------------------
00532351   1/1  tlyrhFgskedLllallerllerllell------------------------------------------
00457241   1/1  tlyrhFkskedLllallerllerllell------------------------------------------
00523931   1/1  tlyryFgsKedLllavlerllerllelllel---------------------------------------
00528861   1/1  ---------------------------------pdplerLrallaallelleedpglgrlllellaealr


                         +         -         -         -         -         *         -:210
query           PALRALALERNELVRGAIERRLPSEPHNPEQASGLVQAVIQGACMQWLIARNGPLDAFMTEQTRQVLSVL
00526551   1/1  ----------------------------------------------------------------------
00491951   1/1  ----------------------------------------------------------------------
00528851   1/1  ----------------------------------------------------------------------
00499101   1/1  ----------------------------------------------------------------------
00495231   1/1  ----------------------------------------------------------------------
00528481   1/1  ----------------------------------------------------------------------
00530961   1/1  ----------------------------------------------------------------------
00526471   1/1  ----------------------------------------------------------------------
00501881   1/1  ----------------------------------------------------------------------
00530651   1/1  ----------------------------------------------------------------------
00528771   1/1  ----------------------------------------------------------------------
00532021   1/1  ----------------------------------------------------------------------
00476771   1/1  ----------------------------------------------------------------------
00527981   1/1  ----------------------------------------------------------------------
00487251   1/1  ----------------------------------------------------------------------
00527421   1/1  ----------------------------------------------------------------------
00528301   1/1  ----------------------------------------------------------------------
00500791   1/1  ----------------------------------------------------------------------
00515851   1/1  ----------------------------------------------------------------------
00495451   1/1  ----------------------------------------------------------------------
00532041   1/1  ----------------------------------------------------------------------
00528451   1/1  ----------------------------------------------------------------------
00515141   1/1  ----------------------------------------------------------------------
00493921   1/1  ----------------------------------------------------------------------
00514661   1/1  ----------------------------------------------------------------------
00528431   1/1  ----------------------------------------------------------------------
00532351   1/1  ----------------------------------------------------------------------
00457241   1/1  ----------------------------------------------------------------------
00523931   1/1  ----------------------------------------------------------------------
00528861   1/1  dpelrerlaallarwraalaelleaaqaeGelradldaealArlllalidGlalqallgpdrfdleaara


                         -         -         -         +         -         -         -:280
query           YPGHTFE---------------------------------------------------------------
00526551   1/1  ----------------------------------------------------------------------
00491951   1/1  ----------------------------------------------------------------------
00528851   1/1  ----------------------------------------------------------------------
00499101   1/1  ----------------------------------------------------------------------
00495231   1/1  ----------------------------------------------------------------------
00528481   1/1  ----------------------------------------------------------------------
00530961   1/1  ----------------------------------------------------------------------
00526471   1/1  ----------------------------------------------------------------------
00501881   1/1  ----------------------------------------------------------------------
00530651   1/1  ----------------------------------------------------------------------
00528771   1/1  ----------------------------------------------------------------------
00532021   1/1  ----------------------------------------------------------------------
00476771   1/1  ----------------------------------------------------------------------
00527981   1/1  ----------------------------------------------------------------------
00487251   1/1  ----------------------------------------------------------------------
00527421   1/1  ----------------------------------------------------------------------
00528301   1/1  ----------------------------------------------------------------------
00500791   1/1  ----------------------------------------------------------------------
00515851   1/1  ----------------------------------------------------------------------
00495451   1/1  ----------------------------------------------------------------------
00532041   1/1  ----------------------------------------------------------------------
00528451   1/1  ----------------------------------------------------------------------
00515141   1/1  ----------------------------------------------------------------------
00493921   1/1  ----------------------------------------------------------------------
00514661   1/1  ----------------------------------------------------------------------
00528431   1/1  ----------------------------------------------------------------------
00532351   1/1  ----------------------------------------------------------------------
00457241   1/1  ----------------------------------------------------------------------
00523931   1/1  ----------------------------------------------------------------------
00528861   1/1  lle-------------------------------------------------------------------