[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF65854.1


[Show Plain Result]

## Summary of Sequence Search
   1::364
 152::359  PF00528 0.0% 34.2541436464088  Binding-protein-dependent transport system inner me 
   1::364


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGQGGALPGASGEGVRASHAQTGVGNI
PF00528         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SDSHYRGGRGLDPEVIAEITHRYGFDKPLHERYFKMLRDYLSFDFNDSLFRSASVLTLIKDSLPVSITLG
PF00528         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LWSTLIIYLVSIPLGIRKAVHNGSRFDVWSSAFIIIGYAIPAFLFAILLIVFFAGGSYYDIFPLRGLVSA
PF00528         -----------illGilaalnrnkkldkllrpliivlsslPsfvlaillvlvf.................


                         -         -         -         +         -         -         -:280
query           NFDTLPWYQKITDYLWHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFR
PF00528         .........vilsilghlilpviillllsaapyvrlirraalrslpkdlveaaralGasrwqifrkvvlP


                         -         *         -         -         -         -         +:350
query           NAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNILSDI
PF00528         nalppiitglilafggl.lggavlleflgswpGlgtllleailgydyseisnggvlalviavlllnlvad


                         -         -         -         -         *         -         -:420
query           SYTLVDPRIDFEGR--------------------------------------------------------
PF00528         ilqrlldpr-------------------------------------------------------------