[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF65871.1


[Show Plain Result]

## Summary of Sequence Search
   1::401
 113::153  PF04143 0.0% 40  YeeE/YedE family (DUF395) 
 290::329  PF04143 0.0% 42.5  YeeE/YedE family (DUF395) 
   1::401


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHAEQWGYYKLIH
PF04143         ----------------------------------------------------------------------
PF04143         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMGCNLAAFFTG
PF04143         ------------------------------------------lrliiGGfLfGfGarLagGCpggallsg
PF04143         ------------------------------------------lrliiGGfLfGfGarLagGCpggallsg


                         +         -         -         -         -         *         -:210
query           IPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGW
PF04143         gsglsl.glvall---------------------------------------------------------
PF04143         gsglsl.glvall---------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ALLTAMHQPKLGLAMLFGIGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGV
PF04143         ----------------------------------------------------------------------
PF04143         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           APKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALAT
PF04143         ---------rliiGGfLfGfGarLagGCpggallsggsglslglvallg---------------------
PF04143         ---------rliiGGfLfGfGarLagGCpggallsggsglslglvallg---------------------


                         -         -         -         -         *         -         -:420
query           SWDKVNLLNTFGPLGGLLVTYLLLFTALMLIIGWEKRFFRRAGLTPAKESV-------------------
PF04143         ----------------------------------------------------------------------
PF04143         ----------------------------------------------------------------------