[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF65890.1


[Show Plain Result]

## Summary of Sequence Search
   1::350
  40::338  PF00793 0.0% 51.3307984790875  DAHP synthetase I family 
   1::350


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNYQNDDLRIKEINELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPAAAK
PF00793         ---------------------------------------s....diliGkddrllviaGPCsiedeeaal


                         -         -         *         -         -         -         -:140
query           EYAARLLALRDELQGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
PF00793         eyAerlkelgeklkddleiimrayfeKpRrstvgfkGlgndedlkilekvkkgl.............glp


                         +         -         -         -         -         *         -:210
query           AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
PF00793         iatevldtisvqyladvvdilqiGArttesqdlleaasglskpvglKkgtd....laidemqaaaekilf


                         -         -         -         +         -         -         -:280
query           SVTKWGHSAIVNTSGNGDCHIILRGGKAPNYSAQHVAEVKEGLIKAGLTPQVMIDFSHANSCKQFQKQME
PF00793         lgv..........tkgvilcerglrggkktnrlvldvsavkvlkeet.ll.pvmvDvsHsnsrkdgkrqe


                         -         *         -         -         -         -         +:350
query           VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGQPLTYGKSITDACIGWEDTDALLRQLSAAVKARRG
PF00793         kVaelakaqiaaG...idGlmiEshlnpgkaksdgkqqlklgksetdacilkeltelv------------