[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF65897.1


[Show Plain Result]

## Summary of Sequence Search
   1::73
  23::71   PF06004 0.0% 53.0612244897959  Bacterial protein of unknown function (DUF903) 
   1::73


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLI
PF06004         ----------------------pyvvttkDGreivtdgkPklDkdtGmyeYkdadGkkvqInkddVkqir


                         -         -         *         -         -         -         -:140
query           KAD-------------------------------------------------------------------
PF06004         e---------------------------------------------------------------------