[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF65921.1


[Show Plain Result]

## Summary of Sequence Search
   1::467
   8::437  PF01654 0.0% 48.2435597189696  Bacterial Cytochrome Ubiquinol Oxidase 
   1::467


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTRNPVWRSLYQFWLKIFAVNFGMGVVS
PF01654         -------laRlqfaltilfHflfvpltlGlalllailetlyvrtgdeeykklakfwgklfainfalGvvt


                         -         -         *         -         -         -         -:140
query           GLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTAFFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLM
PF01654         GivmefqfGtnWseysrfvGdifgapLaiEgllAFflEstflglmlfgwdrvskklhllatllvaigtll


                         +         -         -         -         -         *         -:210
query           STFWILASNSWMHTPQGFEIHNGQVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGN
PF01654         SalwIlvanswmqtPvGaeinaetgraeltdflavifnpsalvkflHtllaayltgafvvlgisawyllr


                         -         -         -         +         -         -         -:280
query           DTPAIRRMFSMALWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAE
PF01654         grekefakkslrialvvaliaailqailGdlsgkevaevqpmKlAamEalwetek..gaplslfgipdee


                         -         *         -         -         -         -         +:350
query           RTRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGLASLWLRYRRR
PF01654         eeenkfaieiPkllsllathsldgevkGlkelaeekikegdevppvavvfwsFrimvglgvlmlllalla


                         -         -         -         -         *         -         -:420
query           LYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVSAHSTLQMSISLLAFFVVYSLV
PF01654         lwllrkkll.ksrwllrllllsiplpfiaveaGWivtevGRqPWvVygllrtaeavsplsaeevllslil


                         -         -         +         -         -         -         -:490
query           FGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVGESLEQEKRE-----------------------
PF01654         fvllyavllvvevflll-----------------------------------------------------