[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF65947.1


[Show Plain Result]

## Summary of Sequence Search
   1::353
  84::146  PF04809 0.0% 34.4262295081967  HupH hydrogenase expression protein, C-terminal con 
 166::282  PF04809 0.0% 49.5726495726496  HupH hydrogenase expression protein, C-terminal con 
 295::341  PF00301 0.0% 59.5744680851064 PF00301 Rubredoxin 
   1::353


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNHSRTIPVVNIAGPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTLIRDMDNPVAT
PF04809         ----------------------------------------------------------------------
PF04809         ----------------------------------------------------------------------
PF00301         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRVREYNADQQRVADEIII
PF04809         -------------eeDlafLdevlGegevk..ilsrgygncritatalrgvWrvqyfnsedkliLdtlei
PF04809         -------------eeDlafLdevlGegevk..ilsrgygncritatalrgvWrvqyfnsedkliLdtlei
PF00301         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GPIPESIWQTHPQPPITPELPPQPAGLMNGAFIAHEIAERVKQPVKEPHIINLTLLPVNDADREYLDHFL
PF04809         tdlPev-------------------gvmnapallaEiaekvaklregaeahvinltllPlseeDlafLde
PF04809         tdlPev-------------------gvmnapallaEiaekvaklregaeahvinltllPlseeDlafLde
PF00301         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLE
PF04809         vlGegevkilsrgygncritatalrgvWrvqyfnsedkliLdtleitdlPevalAakeDledsaerlkev
PF04809         vlGegevkilsrgygncritatalrgvWrvqyfnsedkliLdtleitdlPevalAakeDledsaerlkev
PF00301         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           WLKEYPVTENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDEGNNS
PF04809         le--------------------------------------------------------------------
PF04809         le--------------------------------------------------------------------
PF00301         --------------kyeCkvCgyvydpaegdpdegippgTpFedlpddWvCPvCgagkeqF---------


                         -         -         -         -         *         -         -:420
query           CKD-------------------------------------------------------------------
PF04809         ----------------------------------------------------------------------
PF04809         ----------------------------------------------------------------------
PF00301         ----------------------------------------------------------------------