[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF66015.1


[Show Plain Result]

## Summary of Sequence Search
   1::160
  20::138  PF01464 0.0% 37.8151260504202  Transglycosylase SLT domain 
   1::160


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFH
PF01464         -------------------elilaaeeaygvepsllaaiaqqESsfnpkaisinknksgavGLmQinsst


                         -         -         *         -         -         -         -:140
query           MKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYR
PF01464         akalglkvslseddlldPcknisagakyLksllksyggnlrealaaYNaGagtvkkankyvkkkakka--


                         +         -         -         -         -         *         -:210
query           KLKGMSAEEKNKRLSIAANK--------------------------------------------------
PF01464         ----------------------------------------------------------------------