[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF66055.1


[Show Plain Result]

## Summary of Sequence Search
   1::377
 143::344  PF00924 0.0% 36.1386138613861  Mechanosensitive ion channel 
   1::377


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEYLARLNIVAMLMSTTFWINLAVVFFVTLITYWLINWLLNVVYKALQRPDKKDDAHGRLRPIVFEMLKK
PF00924         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TSKMLIFFAAFLFSLRFVALPDRLFSTLSHAWFLVVAIQMAIWLDQGVQSWMRHLLYAPGSNKNPVTLVI
PF00924         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LGMILRVLVWSMMLLSILANVGVDITALVASLGVGGIAIALAVQTVLSDVFASLSIGFDKPFEIGDFVVF
PF00924         --kilkiliivvgilivlsllgvnvsallavlGalglalglalqdlisnlvaGiillfekpfkiGDlvei


                         -         -         -         +         -         -         -:280
query           NDVAGTIEHIGLKTTRIRSLSGEQIVCANAQLLQQTIHNYKRMQTRRIVFTFGVATATPPEKLRLIGDMV
PF00924         ggieGtVediglrttkirtfdgrivtiPnsslvtssikNlsresgtrrikvsigvtyssdvkklekvlee


                         -         *         -         -         -         -         +:350
query           KKIITDVGETQFDRAHLLAFGQDRLTYEVVHIVNTADYNKYMDIQQEINIRIIEKLIENDIELALPSLVV
PF00924         lkealkekpevlkdkeltvvldefgdsslnfevrvfvktvvpeeylsvqseinlrikkileeeg------


                         -         -         -         -         *         -         -:420
query           RAPVQVEETRDYSNTADAKNADKRVMQ-------------------------------------------
PF00924         ----------------------------------------------------------------------