[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF66076.1


[Show Plain Result]

## Summary of Sequence Search
   1::294
 246::289  PF09163 0.0% 43.1818181818182  Formate dehydrogenase N, transmembrane 
  34::49   PF00037 0.0% 50  4Fe-4S binding domain 
 108::113  PF00037 0.0% 50  4Fe-4S binding domain 
 130::147  PF00037 0.0% 50  4Fe-4S binding domain 
 174::184  PF00037 0.0% 72.7272727272727  4Fe-4S binding domain 
   1::294


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVGHCVGVYDNPA
PF09163         ----------------------------------------------------------------------
PF00037         ---------------------------------ideekCigCGaCvevC---------------------
PF00037         ---------------------------------ideekCigCGaCvevC---------------------
PF00037         ---------------------------------ideekCigCGaCvevC---------------------
PF00037         ---------------------------------ideekCigCGaCvevC---------------------


                         -         -         *         -         -         -         -:140
query           DLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSEHCIGCGYCI
PF09163         ----------------------------------------------------------------------
PF00037         -------------------------------------CvevCP----------------eekCigCGaCv
PF00037         -------------------------------------CvevCP----------------eekCigCGaCv
PF00037         -------------------------------------CvevCP----------------eekCigCGaCv
PF00037         -------------------------------------CvevCP----------------eekCigCGaCv


                         +         -         -         -         -         *         -:210
query           AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELGEQRVEKLKARGFEH
PF09163         ----------------------------------------------------------------------
PF00037         evCPvgA--------------------------aCvevCPvgAI--------------------------
PF00037         evCPvgA--------------------------aCvevCPvgAI--------------------------
PF00037         evCPvgA--------------------------aCvevCPvgAI--------------------------
PF00037         evCPvgA--------------------------aCvevCPvgAI--------------------------


                         -         -         -         +         -         -         -:280
query           AGIYNPQGVGGTHVMYVLHHANQPELYHGLPKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIG
PF09163         -----------------------------------IsplVklWKGvlKplgalamvatalagflHyitvG
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PNKETDDDEEDHHE--------------------------------------------------------
PF09163         Pneveeeee-------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------