[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF66209.1


[Show Plain Result]

## Summary of Sequence Search
   1::71
  16::70   PF09392 0.0% 22.2222222222222  Type III secretion needle MxiH like 
   1::71


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDIAQLVDMLSHMAHQAGQAINDKMNGNDLLNPESMIKAQFALQQYSTFINYESSLIKMIKDMLSGIIAK
PF09392         ---------------aaarasasevtstasvsdperllelQmelvkysllmdltSklvgkstqtldtLv.


                         -         -         *         -         -         -         -:140
query           I---------------------------------------------------------------------
PF09392         ----------------------------------------------------------------------