[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF66317.1


[Show Plain Result]

## Summary of Sequence Search
   1::82
  10::72   PF02604 0.0% 22.2222222222222  Phd_YefM 
   1::82


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDEELGRIIDERA
PF02604         ---------tvsiseaknnlselldevekgeepivItrnGkpvaVlvsledyerlqeatlyllslllnae


                         -         -         *         -         -         -         -:140
query           NERVIEVNIDDL----------------------------------------------------------
PF02604         rl--------------------------------------------------------------------