[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF66348.1


[Show Plain Result]

## Summary of Sequence Search
   1::339
  24::130  PF08240 0.0% 47.6635514018692  Alcohol dehydrogenase GroES-like domain 
 171::296  PF00107 0.0% 26.6129032258065  Zinc-binding dehydrogenase 
   1::339


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGD
PF08240         -----------------------pgevlvkvkaaGiCgsDlhivkgekelevklplilGhEivGiveevg
PF00107         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYAVAPARNAHRIPDNIADHHA
PF08240         egvkklkvGdrvvvepliscgeCeaCkegeenlceeakllgvkldGgfaeyvvvpekklv----------
PF00107         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWT
PF08240         ----------------------------------------------------------------------
PF00107         ------------------------------GvGlaavqlAkalG..arviavdsseeklelakelGadhv


                         -         -         -         +         -         -         -:280
query           LNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIY
PF08240         ----------------------------------------------------------------------
PF00107         inskdedfvkaireltggkgvdvviecvgagatfeqalkllapgGrvvvvggtsganvefdlrklllkek


                         -         *         -         -         -         -         +:350
query           SSRLNANKFPVVIDWLNKGLIDPDKLITHTFDYQHVTDAIELFEKDQRQCCKVLLTFAK-----------
PF08240         ----------------------------------------------------------------------
PF00107         tiqGsllgnpeeleea------------------------------------------------------