[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF66691.1


[Show Plain Result]

## Summary of Sequence Search
   1::588
  26::289  PF00664 0.0% 21.969696969697  ABC transporter transmembrane region 
 390::513  PF00005 0.0% 37.5  ABC transporter 
 379::408  PF02463 0.0% 30  RecF/RecN/SMC N terminal domain 
 497::551  PF02463 0.0% 32.7272727272727  RecF/RecN/SMC N terminal domain 
 361::398  PF03193 0.0% 43.2432432432432  Protein of unknown function, DUF258 
   1::588


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKTRQKDLTRWLKQQSVISQRWLNISRLLGFMSGVLIVAQAWIMARILQHMIMENIPREALLLPFILLI
PF00664         -------------------------lailllilagvtalvfplllgrlldsvsdgndeersslyslaill
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LVFVLRAWVVWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAGSWATLVLEQIDDMHDYYARY
PF00664         iavgvlivlllqgsfyllertgqrirkrlfrallrkilglfdsffdknsvGellsrltnDvskirdglgd
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFMAMVGMGAADANRRNFLALARLSGHFLDRLR
PF00664         klglffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqkayakagavaeEal
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GMETLRIFGRGEAETESIRAASQDFRQRTMEVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGH
PF00664         sgirtVkafggeekeleryekaleeakkagikkaitagllfgftqlisylsyalalwfgtflsvisgels
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YGTGVTLAAGFLALILAPEFFQPLRDLGTFYHAKAQAVGAADSLKTFLETPLAHPARGEVELAENEPVTI
PF00664         vgtvfafls-------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES
PF00664         ----------------------------------------------------------------------
PF00005         ---------------------------------------STLlklltgelkptegeievdndrkdlesdk
PF02463         ----------------------------taivGpNGSGKsnvldAilFvLGeksakkl------------
PF02463         ----------------------------taivGpNGSGKsnvldAilFvLGeksakkl------------
PF03193         ----------ktkegleelaellkd.ktsvlvGqSGvGKSsLinallp----------------------


                         -         -         +         -         -         -         -:490
query           WRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGQ
PF00664         ----------------------------------------------------------------------
PF00005         leklr..igyipqdpllfpeltvrenldmakeekktdkrieevlekvgldelldk..........srvst
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           AQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLADWDAIWVMQDGA
PF00664         ----------------------------------------------------------------------
PF00005         LSgGqkqrvalArallkkpklll-----------------------------------------------
PF02463         ------AiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekad---------
PF02463         ------AiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislreemlekad---------
PF03193         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           IVEQGSYAELSAANGAFATLLAHRQEDI------------------------------------------
PF00664         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------