[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF66838.1


[Show Plain Result]

## Summary of Sequence Search
   1::370
   8::362  PF00465 0.0% 41.3294797687861  Iron-containing alcohol dehydrogenase 
  65::300  PF01761 0.0% 18.9189189189189  3-dehydroquinate synthase 
   1::370


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNTFSLQTRLYSGQGSLAVLKRFTNKHIWIICDGFLAHSPLLDTLRNALPADNRISVFSEITPAPTIHTV
PF00465         -------tkivfgkgaleelgeelkklgkvlivtdkslkklglldkvlesLkeagievtvfdgvepeptl
PF01761         ----------------------------------------------------------------etlekl


                         -         -         *         -         -         -         -:140
query           VQGIAQMQALQPQVVIGFGGGSAMDAAKAIVWFSQQSGINIETCVAIPTTSGTGSEVTSACVISDPDKGI
PF00465         eeveeaaalareekadvivAvGGGsviDtAKaiallltnpgelldyegkakkkkkpalpliaiPTtaGtG
PF01761         ldalleagltrksvlialGGGvigDlagfaAa.tylrGvr...fiqvPTtllaqvDssvGgktainlpeg


                         +         -         -         -         -         *         -:210
query           KYPLFNNALYPDMAILDPELVVSVPPQITANTGMDVLTHALEAWVSPRASDFTDALAEKAAKLVFQYLPT
PF00465         sevtplavitdeegkrklsiaspkllPdlaivDpeltltlPkrvtaatglDalthalEayvskkanplsd
PF01761         k...nligafaqPkaVliDldvLktlperelraGlaEviKyglikdaelfelleeeeeaelaak..rdee


                         -         -         -         +         -         -         -:280
query           AVEKGDCVATRGKMHNASTLAGMAFSQAGLGLNHAIAHQLGGQFHLPHGLANALLLTTVIRFNAGVPRAA
PF00465         alaeealrliaenlpravadpedleareqmllastlAGlafsnaglgaaHalahalgglfgipHGeavai
PF01761         aleelikr..sieskaavvaaDeke..gglrallnlgHtfgHalEallgygkllHGeaVaiGmvlaakls


                         -         *         -         -         -         -         +:350
query           KRYARLAKACGFCPAEANDIAAINALIQQIELLKQRCVLPSLAVALKEGRSDFSARIPAMVQAALADVTL
PF00465         llpavlrfna..aaaperyarlaralgvd.egsdeealaeeliealrellkelglptsLkdlgvte....
PF01761         eklgllskeeverikkllkk--------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RTNPRPANAEAIRELLEELL--------------------------------------------------
PF00465         ..edldelaeaa----------------------------------------------------------
PF01761         ----------------------------------------------------------------------