[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67119.1


[Show Plain Result]

## Summary of Sequence Search
   1::263
   3::259  PF02548 0.0% 54.0856031128405  Ketopantoate hydroxymethyltransferase 
   1::263


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PF02548         --kvtikdlkkkkkegekivmltaydastaklvdeagvdvilVGdslgmvvlgeestlpvtleemiyhtk


                         -         -         *         -         -         -         -:140
query           AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PF02548         aVargakralvvadlPfgsyeaseeqalknaarllkeagadavkleggeelaetvkalveagipVmgHiG


                         +         -         -         -         -         *         -:210
query           PQSVNIFGGYKIQGRGDAGQVLLDDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQ
PF02548         LtPqsvnalGgykvqGrkeeeaeklledakaleeaGafaivlEcvpeelakeiteklsiptiGiGaGaac


                         -         -         -         +         -         -         -:280
query           ILVMHDAFGITGGHIPKFAKNFLAEAGDMRAAVQQYMAEVESGVYPGEEHSFH-----------------
PF02548         dGqvlvleDllGleeekkpkfvkkyadlaeeieealkaYaeevksgkFP---------------------