[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67239.1


[Show Plain Result]

## Summary of Sequence Search
   1::309
 215::253  PF00165 0.0% 23.0769230769231  Bacterial regulatory helix-turn-helix proteins, Ara 
 270::304  PF00165 0.0% 41.1764705882353  Bacterial regulatory helix-turn-helix proteins, Ara 
   1::309


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MENVTFVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLVCFRSGKLTISNNHDTIY
PF00165         ----------------------------------------------------------------------
PF00165         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           CDEPGMLVLKKEQVVNVTLEEVNGHMDFDILEIPTQRLGALYALIPNEQQTKMAVPTEKAQKIIYTPDFP
PF00165         ----------------------------------------------------------------------
PF00165         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ARREVFEHLKTAFSCTKDTSKGCSNCNNKSCIENEELIPYFLLFLLTAFLRLPESYEIILSSAQITLKER
PF00165         ----------------------------------------------------------------------
PF00165         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKC
PF00165         ----LeenlstnwsiadiAeevgfSpsyfsrlFkkytGvtPsq----------------nwsiadiAeev
PF00165         ----LeenlstnwsiadiAeevgfSpsyfsrlFkkytGvtPsq----------------nwsiadiAeev


                         -         *         -         -         -         -         +:350
query           GYDSTSYFIQCFKKYFKTTPSTFIKMANH-----------------------------------------
PF00165         gf.SpsyfsrlFkkytGvtPsqyr----------------------------------------------
PF00165         gf.SpsyfsrlFkkytGvtPsqyr----------------------------------------------