[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67256.1


[Show Plain Result]

## Summary of Sequence Search
   1::303
   1::303  PF09306 0.0% 92.7392739273927  Bacteriophage, scaffolding protein 
   1::303


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEPTTEIQATEDLTLSGDHAAASADSLVVDNANDNAGQEEGFEIVLKDDETAPKQDPAKNAEFARRRIER
PF09306         meqtteiqaseeltlsgdhaaasadslvvdnandnagqeegfeivlkddetkpkqdpaknaefarrrier


                         -         -         *         -         -         -         -:140
query           KRQRELEQQMEAVKRGELPESLRVNPDLPPQPDINAYLSEEGLAKYDYDNSRALAAFNAANTEWLMKAQD
PF09306         krqreleqqmeavkrgelpeslrvnpelpkqpdindylseealakydydqsralaafqaansewlikaqd


                         +         -         -         -         -         *         -:210
query           ARSNAVAEQGRKTQEFTQQSAQYVEAARKHYDAAEKLNIPDYQEKEDAFMQLVPPAVGADIMRLFPEKSA
PF09306         arsqavaeqgrktqeftqksaqyveaarkhydaaeklnipdyqekedafmqlvppavgadimrlfpeksa


                         -         -         -         +         -         -         -:280
query           ALMYHLGANPEKARQLLAMDGQSALIELTRLSERLTLKPRGKQISSAPPADQPITGDVSAANKDAIRKQM
PF09306         almyhlganpekarqllamdgqsalieltrlserltlkprakqvseapladepitgdvvaankdaiekqm


                         -         *         -         -         -         -         +:350
query           DAAASKGDVETYRKLKAKLKGIR-----------------------------------------------
PF09306         eaaaskgdvetyrklkaklnkgi-----------------------------------------------