[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67339.1


[Show Plain Result]

## Summary of Sequence Search
   1::135
   3::123  PF00903 0.0% 30.5084745762712  Glyoxalase/Bleomycin resistance protein/Dioxygenase 
   1::135


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGN
PF00903         --idhvalavgdleksldFYtkvLGfklvkktdn.teet..eglriaffhaggghielvlneapsgaakh


                         -         -         *         -         -         -         -:140
query           AYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKDAGRGLGN-----
PF00903         vkkieetvhhvafialdvedvgkaldrlkeagvkvvaepgrhyfgalysfyfr-----------------