[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67354.1


[Show Plain Result]

## Summary of Sequence Search
   1::137
  50::127  PF03061 0.0% 33.3333333333333  Thioesterase superfamily 
   1::137


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFGLLHGGASAALAETLGSMAG
PF03061         -------------------------------------------------gGivhgGvylalldeaaglal


                         -         -         *         -         -         -         -:140
query           YLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG---
PF03061         rslggsgqgvvvvelnidFlrpvrlgdvltvearvlrlgrtsavvevevrdedgrlv-------------