[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67435.1


[Show Plain Result]

## Summary of Sequence Search
   1::302
  89::295  PF03466 0.0% 32.6732673267327  LysR substrate binding domain 
   6::65   PF00126 0.0% 45  Bacterial regulatory helix-turn-helix protein, lysR 
   1::302


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQLNMLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSMTDEGEEFYQR
PF03466         ----------------------------------------------------------------------
PF00126         -----lrqLrlFvavaetgsftaAAerLglsqpavSrqikrLEeelgvpLfeRsgrglrlTeaGe-----


                         -         -         *         -         -         -         -:140
query           CLSLLSELDDVRRLFSSTQPPKGRLRLDVPITLARAVIIPALGDFQNRYPDIEIVLGTSDRKIDLIAERV
PF03466         ------------------gglrgrLrigapptlaayllppllarfraryPevelelvegdseelldllae
PF00126         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPHSIDELMKSHRAVNFFSNHSLQIMEWKFTVD
PF03466         gelDlairrgppedpglearpLaeeplvlvappdhpLaa.repvsledLad.eplilleegsg...lrdl
PF00126         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GSIASIKIPSSILVDNSEAFLSCGLAGLGVLHGLRPSLAPFIASGELTEILTDFPPPPKPVSLLYPDRRY
PF03466         vedalaeaglkprvalevnsleallalvaaGlGiallprsavrdeladgrlvvlplpdpplprtlylvyr
PF00126         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LAPKVRVFIDWLCEVFGPDAHL------------------------------------------------
PF03466         kgrelspavrafidf-------------------------------------------------------
PF00126         ----------------------------------------------------------------------