[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67448.1


[Show Plain Result]

## Summary of Sequence Search
   1::566
  86::528  PF07969 0.0% 32.1808510638298  Amidohydrolase family 
  86::371  PF01979 0.0% 20.1342281879195  Amidohydrolase family 
 478::529  PF01979 0.0% 38.4615384615385  Amidohydrolase family 
   1::566


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MISLVPPLLSRTALLFLLTATGAATAARPAADIILHNGNIITLNDAQPQASALAISGSRIVAIGDDTATD
PF07969         ----------------------------------------------------------------------
PF01979         ----------------------------------------------------------------------
PF01979         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EWRGDHTRTIDLQGKTVIPGLTDTHIHAIRGGQTWTFETYWYDSPSLKDALDKLRADANRRPHDQWVAVV
PF07969         ---------------lvlPGFvDsHtHldggglnlgraldlsgvgsvaallallrdaaak........vg
PF01979         ---------------ivlPGlIDaHvHleqsllr....................................
PF01979         ---------------ivlPGlIDaHvHleqsllr....................................


                         +         -         -         -         -         *         -:210
query           GSWIPAQFAENRAPTVAELSHALPDHPAYIQYLYDYALVNQRGIDVLGLNDTPPPDLAGIGVERDAKGSA
PF07969         hgwdeaqlaerrlpetradlaadaaspdnpvllhrvddhlavlnsaalel...................a
PF01979         ......................................................................
PF01979         ......................................................................


                         -         -         -         +         -         -         -:280
query           TGKLFGDIAAFNQLFASISSNADREGGLRQFFADMNARGVTGIIDPSAGPAAAYEPLFAMRNQGDLPLRV
PF07969         agnptgaLrenaadlglealpatladlaemakilraaikelnalGittiqdgagfeagpaellealrala
PF01979         ....................eedsyeaiktgakealrsGtTtvldtptsantsval......rkeidegl
PF01979         ....................eedsyeaiktgakealrsGtTtvldtptsantsval......rkeidegl


                         -         *         -         -         -         -         +:350
query           GYRIPVQPEAKGHEAQWFSNLMAFRPARADDGQLAFLGLGESLVAGMNDGVRMAPGFSSSDQDKTALRQV
PF07969         eegklpvrvhlhv...............................rlggvkifvdGalgsrtallelpdya
PF01979         aaapklealvelllkgevggraelgevvidraageeeei.....egadlikvieaggkgakaidgvlpal
PF01979         aaapklealvelllkgevggraelgevvidraageeeei.....egadlikvieaggkgakaidgvlpal


                         -         -         -         -         *         -         -:420
query           ATFAAKRGIPLEIHAYTDDSADAILTIFEQVAQQYDLRPLRWSIAHLNTGSPQTLERMRKLGLAYTVQMG
PF07969         dapgaeidisgepidsaeeleelvaaaraaglqvavhasgdaaidavlnayeavlkdg.......rleha
PF01979         aphdaqtvskeelkaevelae-------------------------------------------------
PF01979         aphdaqtvskeelkaevelae-------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PYFEGLAIRDANPPGATDNSPPVRLALDKGLVVAGGTDSTRIGIAGVWHAIEYHITGIASGGSVRKPASE
PF07969         evattdqidraaelglaadvqphflatdggewvdsrlgperarlslpiaallnaGvkvalgsDapv.atl
PF01979         ---------------------------------------------------------g............
PF01979         ---------------------------------------------------------g............


                         *         -         -         -         -         +         -:560
query           RLTRLEALALYTRHAAWLAFAEQHRGQLSVGKQADLAVLNQPFMTMPEDRIDTIRAVLTLVDGRIVHESP
PF07969         dPwlgigaavtrktaeelegrvlkpe.erlsleealal--------------------------------
PF01979         .lspkealrmaTinpAkalglddeiGsievGkdADlvvl-------------------------------
PF01979         .lspkealrmaTinpAkalglddeiGsievGkdADlvvl-------------------------------


                         -         -         -         *         -         -         -:630
query           DLNAGQ----------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF01979         ----------------------------------------------------------------------
PF01979         ----------------------------------------------------------------------