[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67603.1


[Show Plain Result]

## Summary of Sequence Search
   1::146
  25::114  PF04828 0.0% 27.906976744186  Glutathione-dependent formaldehyde-activating enzym 
   1::146


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQTFTGRCLCGQSHFTVDVEMLDVYACHCTLCQKWSGGIAMYLEACGQPQLAPLSPEPPYFSSSSRGERY
PF04828         ------------------------alChCsdCrkasgsaftanavvkaeavtltsgeeelkeyeksgnkv


                         -         -         *         -         -         -         -:140
query           FCSGCGCPLWFRLTDTDRYFIPWTLLELNEVDRRRLILAAEIYTETQPAFWRLTGQYARLSGKEVEEMDS
PF04828         sryfCpeCgsplyaeeseapelvivrlgtlddp....eelkpea--------------------------


                         +         -         -         -         -         *         -:210
query           PCQLAH----------------------------------------------------------------
PF04828         ----------------------------------------------------------------------