[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67677.1


[Show Plain Result]

## Summary of Sequence Search
   1::220
  64::170  PF01058 0.0% 32.0754716981132  NADH ubiquinone oxidoreductase, 20 Kd subunit 
   1::220


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
PF01058         ---------------------------------------------------------------csislla


                         -         -         *         -         -         -         -:140
query           SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
PF01058         leeslldlldlielryhetll.adskeeeieaeekeadvlvveGavtrkpkealellkelaekakaviav


                         +         -         -         -         -         *         -:210
query           VVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQPERERKRGERIA
PF01058         GtCAafGGipaaannpsvgeevgellevvp----------------------------------------


                         -         -         -         +         -         -         -:280
query           VTNLRTPDEI------------------------------------------------------------
PF01058         ----------------------------------------------------------------------