[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67703.1


[Show Plain Result]

## Summary of Sequence Search
   1::295
  30::135  PF00892 0.0% 26.4150943396226  EamA-like transporter family 
 159::278  PF00892 0.0% 24.1666666666667  EamA-like transporter family 
   1::295


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPGSTRKLPVWLPILVLLIAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQ
PF00892         -----------------------------lskkllesvspltitayrlliagillilllfllrepialis
PF00892         -----------------------------lskkllesvspltitayrlliagillilllfllrepialis


                         -         -         *         -         -         -         -:140
query           RLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFIWVVLAVLGLWFLLPLGQ
PF00892         lkdilallllgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgi-----
PF00892         lkdilallllgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgi-----


                         +         -         -         -         -         *         -:210
query           DMSHVDLTGAALALGAGACWAVYILTGQRAGAEHGPATVAVGSLIAAIIFVPIGAVQAGDALWHWSILPL
PF00892         ------------------swaiyfvlskkllesvspltitayrlliagillilllfllrepialislkdi
PF00892         ------------------swaiyfvlskkllesvspltitayrlliagillilllfllrepialislkdi


                         -         -         -         +         -         -         -:280
query           GLAVAVLSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGST
PF00892         lallllgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlillGv--
PF00892         lallllgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlillGv--


                         -         *         -         -         -         -         +:350
query           LTIRREPQIKQVDVK-------------------------------------------------------
PF00892         ----------------------------------------------------------------------
PF00892         ----------------------------------------------------------------------