[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67711.1


[Show Plain Result]

## Summary of Sequence Search
   1::404
   2::246  PF00109 0.0% 27.8969957081545  Beta-ketoacyl synthase, N-terminal domain 
 254::362  PF02801 0.0% 40.3669724770642  Beta-ketoacyl synthase, C-terminal domain 
 144::223  PF00108 0.0% 20.5128205128205  Thiolase, N-terminal domain 
   1::404


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSD
PF00109         -epvaivGmgcrfpggvgpeefwelllegrdaisefpadrdaselydpdsraageiysreggfldddfda
PF02801         ----------------------------------------------------------------------
PF00108         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMAS
PF00109         affgispreaeamDpqqrlaleaawealedagldpeslegsdrvgvfiGsgig...dy..aelqaldeag
PF02801         ----------------------------------------------------------------------
PF00108         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
PF00109         gkprkvspyatgaalpsviagrisyalglrGpsvtvdtacsSs.lvalhaavqslregeadlalaGGvel
PF02801         ----------------------------------------------------------------------
PF00108         ---aalkaglpeevpaltvnkvCgSglkavalaaqkiaageadivvagGvEsmsnapylle..asraglk


                         -         -         -         +         -         -         -:280
query           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
PF00109         llspetfaafsaag.llspd..grckafdpfa...d----------------------------------
PF02801         -------------------------------------------yaviagsavnqdgaasnsltapngeaq
PF00108         lgkaklvdsllkd---------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLML
PF00109         ----------------------------------------------------------------------
PF02801         arairkalaeagldpedvdyveahGtGtplgDpiEaealkavfgekarkqplavgSvKsniGHleaAaGv
PF00108         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EHGFIAPSINIEELDEQAAGLNIVTETTERELTTVMSNSFGFGGTNATLVMRKL----------------
PF00109         ----------------------------------------------------------------------
PF02801         aelikvvlalrh----------------------------------------------------------
PF00108         ----------------------------------------------------------------------