[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67742.1


[Show Plain Result]

## Summary of Sequence Search
   1::643
  89::296  PF01578 0.0% 36.7875647668394  Cytochrome C assembly protein 
 429::474  PF01578 0.0% 21.7391304347826  Cytochrome C assembly protein 
   1::643


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMPEYGHALLCLALGVALLLSVYPLWGVARGDARMMASAGVFAWLLFICVAGAFFVLVHAFVVNDFTVAY
PF01578         ----------------------------------------------------------------------
PF01578         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VAGNSNTQLPVWYRVAATWGAHEGSLLLWVLLMSGWTLAVAVFSRQVPADIVARVLAVMGMVCAGFLAFI
PF01578         ------------------lsnleesllllawilsllgllleylarklnlsllaavaliaalillgfalf.
PF01578         ------------------lsnleesllllawilsllgllleylarklnlsllaavaliaalillgfalf.


                         +         -         -         -         -         *         -:210
query           LFTSGPFARTLPAFPVEGRDLNPLLQDPGLIFHPPLLYMGYVGFSVAFAFAIAALLSGRLDSAFTRFARP
PF01578         .........lllaelqesadlnpalqspilmiHvplallsYatliigallsialliierqlkkkkklkls
PF01578         .........lllaelqesadlnpalqspilmiHvplallsYatliigallsialliierqlkkkkklkls


                         -         -         -         +         -         -         -:280
query           WTLAAWVFLTLGIVLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALLHSLAVTEQRAGFKAWTLLLS
PF01578         anlkllkqldrlsyriiliGfvlltigiilGsvWa..eeaWGsywsWDpketaslitWlvfaallhsri.
PF01578         anlkllkqldrlsyriiliGfvlltigiilGsvWa..eeaWGsywsWDpketaslitWlvfaallhsri.


                         -         *         -         -         -         -         +:350
query           ICAFSLCLLGTFLVRSGVLVSVHAFASDPARGMFILAFMVLVTGGSLLLFAVRGHRVRSRVNNALWSRES
PF01578         .ek.gwrgkkaailai------------------------------------------------------
PF01578         .ek.gwrgkkaailai------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LLLGNNVLLMAAMLVVLLGTLLPLVHKQLGLGSISVGEPFFNTMFTWLMVPFALLLGVGPLVRWGRDRPR
PF01578         ----------------------------------------------------------------------
PF01578         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           NIRTLLLTALVSTLVLSVLLPWLLEDKIIAMTAVGMAMACWIAVLAVAEAVQRVSRGTKTSLSYWGMVAA
PF01578         --------awilsllgllleylarklnlsllaavaliaalillgfalflllael----------------
PF01578         --------awilsllgllleylarklnlsllaavaliaalillgfalflllael----------------


                         *         -         -         -         -         +         -:560
query           HLGLAVTITGIAFSQNYSVERDVRMRAGDSVTIHDYRFTFPEVRDITGPNYRGGVALIGVTRHGEPEAVL
PF01578         ----------------------------------------------------------------------
PF01578         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           HAEKRLYNTSRMVMTEAAIDGGLTRDLYAALGEELDNGAWAVRLYYKPFVRWIWAGGLLMALGGLLCLAD
PF01578         ----------------------------------------------------------------------
PF01578         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           PRYRRRKPLPEAG---------------------------------------------------------
PF01578         ----------------------------------------------------------------------
PF01578         ----------------------------------------------------------------------