[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67784.1


[Show Plain Result]

## Summary of Sequence Search
   1::242
  42::170  PF00005 0.0% 41.5929203539823  ABC transporter 
  31::46   PF02463 0.0% 43.75  RecF/RecN/SMC N terminal domain 
 134::211  PF02463 0.0% 31.4285714285714  RecF/RecN/SMC N terminal domain 
  27::52   PF03193 0.0% 46.1538461538462  Protein of unknown function, DUF258 
   1::242


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIQLNGINCFYGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLTIAGNHFDFTK
PF00005         -----------------------------------------STLlklltgelkptegeievd.n..drkd
PF02463         ------------------------------taivGpNGSGKsnvld------------------------
PF02463         ------------------------------taivGpNGSGKsnvld------------------------
PF03193         --------------------------kdktsvlvGqSGvGKSsLinallpel------------------


                         -         -         *         -         -         -         -:140
query           TPSDKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKDQALARAEKLLERLRLKPYSDRYPL
PF00005         les.dkleklr..igyipqdpllfpeltvrenldmakeekk..........tdkrieevlekvgldelld
PF02463         ---------------------------------------------------------------e......
PF02463         ---------------------------------------------------------------e......
PF03193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIHELAETNITQVIVTHEVEVARKTASR
PF00005         ksrvstLSgGqkqrvalArallkkpklllL----------------------------------------
PF02463         lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn..aQfivislreemle
PF02463         lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn..aQfivislreemle
PF03193         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VIYMENGHIVEHGDAGCFAHPQTEAFKNYLSH--------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         k---------------------------------------------------------------------
PF02463         k---------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------