[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF67786.1


[Show Plain Result]

## Summary of Sequence Search
   1::233
  56::152  PF00038 0.0% 15.625  Intermediate filament protein 
  63::158  PF04582 0.0% 21.875  Reovirus sigma C capsid protein 
  50::131  PF08614 0.0% 19.5121951219512  Autophagy protein 16 (ATG16) 
  58::150  PF04156 0.0% 16.1290322580645  IncA protein 
  60::143  PF05667 0.0% 21.4285714285714  Protein of unknown function (DUF812) 
  83::132  PF04102 0.0% 24 PF04102 SlyX 
   1::233


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
PF00038         -------------------------------------------------------qyeelaeknreeae.
PF04582         --------------------------------------------------------------lddvkael
PF08614         -------------------------------------------------gelaqrllllneeleekreei
PF04156         ---------------------------------------------------------dekieesrlqeel
PF05667         -----------------------------------------------------------edrtkerekel
PF04102         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
PF00038         ewykakleelqeeaeknsealrsakeeitelrrqiqsleieleslkkqkeslerqlaeleerleeelkkl
PF04582         kelstevaalqssvdslsseladlselvsahdaalsslqtevdanstdisnlksdvsanglnitdleerv
PF08614         aekekelaelqseiksleeeikdleeelkekekaletlqDElaslnlelslleeklsklqk---------
PF04156         sesesqlseleeeleqleerlaeleseledleedlellqeelksleerlesleesikelakeirelreei
PF05667         ealqeqidelessieeveeeikalkskikeveeeleevkeeneeleeevkikkrtvelledaeenvakLq
PF04102         ------------rieeLEiklafqedtieeLNevvaeqqkeidrlqrqlrllaerlkelees--------


                         +         -         -         -         -         *         -:210
query           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
PF00038         qekiseleeelq----------------------------------------------------------
PF04582         kslesgsstglsfsdPls----------------------------------------------------
PF08614         ----------------------------------------------------------------------
PF04156         sdlkeevqel------------------------------------------------------------
PF05667         alv-------------------------------------------------------------------
PF04102         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ALITERRRTKALEDALRAHGLID-----------------------------------------------
PF00038         ----------------------------------------------------------------------
PF04582         ----------------------------------------------------------------------
PF08614         ----------------------------------------------------------------------
PF04156         ----------------------------------------------------------------------
PF05667         ----------------------------------------------------------------------
PF04102         ----------------------------------------------------------------------