[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68113.1


[Show Plain Result]

## Summary of Sequence Search
   1::385
  40::379  PF00155 0.0% 27.1084337349398  Aminotransferase class I and II 
  82::210  PF00266 0.0% 24.8062015503876  Aminotransferase class-V 
  85::150  PF01212 0.0% 30.3030303030303  Beta-eliminating lyase 
  85::212  PF01041 0.0% 23.3870967741935  DegT/DnrJ/EryC1/StrS aminotransferase family 
 263::352  PF01041 0.0% 20.9302325581395  DegT/DnrJ/EryC1/StrS aminotransferase family 
  26::122  PF00202 0.0% 28.2608695652174  Aminotransferase class-III 
 187::291  PF00202 0.0% 26.7326732673267  Aminotransferase class-III 
  86::206  PF01053 0.0% 23.9669421487603  Cys/Met metabolism PLP-dependent enzyme 
   1::385


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFG
PF00155         ---------------------------------------dvinLgsneylgdsgkptlpevakaeke..g
PF00266         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------
PF01041         ----------------------------------------------------------------------
PF01041         ----------------------------------------------------------------------
PF00202         -------------------------itkakGvyltdvdGrrylDflsgiavvnlG.hahpkiveavkeqa
PF00202         -------------------------itkakGvyltdvdGrrylDflsgiavvnlG.hahpkiveavkeqa
PF01053         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VGSGGSGHISGYSVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
PF00155         alaggtlneygpidglpeleealakflgrseklklkreaavvvgsGagaliealifllklnpgdeilvpd
PF00266         -----------atealeearekvaelinaeseeeiiFtsgttealnlvalslarslkagdeilvteaehh
PF01212         --------------tvarledavaellgkeaalfvpsGtaAnqialsallqreeevvvtepshihfdetg
PF01041         --------------eveeFEkafaeylgvkhavavssGtaAlllaLralgigpGdeVIvpsltfvAtana
PF01041         --------------eveeFEkafaeylgvkhavavssGtaAlllaLralgigpGdeVIvpsltfvAtana
PF00202         dklshvsfraltte....palklaeklaeltPkgldkvflansGseanetAl------------------
PF00202         dklshvsfraltte....palklaeklaeltPkgldkvflansGseanetAl------------------
PF01053         ---------------revleeriaaLeggeaalavsSGmaAiaaallallkaGdevvatddlYggtqrll


                         +         -         -         -         -         *         -:210
query           NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
PF00155         ptyasyknilrlsggevvryplyseedfhldlealeealkeapegnkktkvvlvesphNPtGtvatleel
PF00266         anlvpwqelakrtgakvkvipvdeegsldldeleklltpktklvaithvsnvtGvvqpveeiaklakeag
PF01212         aikelggvkl------------------------------------------------------------
PF01041         vlqlGakpv.fvDvdpetlnldpaaieaaitpr...tkaIlpVhlyGqpadmdairaiaaehglkvieDa
PF01041         vlqlGakpv.fvDvdpetlnldpaaieaaitpr...tkaIlpVhlyGqpadmdairaiaaehglkvieDa
PF00202         ----------------------------------------------laklreickkhnvllivDEvqtGf
PF00202         ----------------------------------------------laklreickkhnvllivDEvqtGf
PF01053         ekvlkklgvevkfvdtsdleelekaikpntklvylEtptnpllkvvDieaiaklakkkgdvlvvvD----


                         -         -         -         +         -         -         -:280
query           VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMPPAQAQALSASL
PF00155         eklldlakkynlllfvDeaYagfvfgsldavatranveeepnllivgslsKafGlaGeRvGyilgnaavv
PF00266         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------
PF01041         Aq--------------------------------------------------GynlrltelqAavglaqL
PF01041         Aq--------------------------------------------------GynlrltelqAavglaqL
PF00202         GrtGkl..fAaehagvepDlmtlaKaltgGlplsavlataevmqafqpgs..hgttfggnplacavalav
PF00202         GrtGkl..fAaehagvepDlmtlaKaltgGlplsavlataevmqafqpgs..hgttfggnplacavalav
PF01053         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AVIRSDEGGERREKLAALVQRFRAGVNASRFTLLNAHSAIQPLIVGDNSRALRLAEALRQQGCWATAIRP
PF00155         sqlrklsrpflsssllqaavaaalsdallkqs..eleemrqrlqkrrkelrdeLaelglkvlasqsgmfl
PF00266         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------
PF01041         ekl..deliarrreiaelykeelaelpgleeltepteeseaawhlfpvllkeeaavsrdelvealkeegi
PF01041         ekl..deliarrreiaelykeelaelpgleeltepteeseaawhlfpvllkeeaavsrdelvealkeegi
PF00202         levieeeelle-----------------------------------------------------------
PF00202         levieeeelle-----------------------------------------------------------
PF01053         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PTVPVGTARLRLTLTQAHEACDIDRLLEVLHGAGE-----------------------------------
PF00155         ltdlsaetakelskkLleevgvyvtpgts-----------------------------------------
PF00266         ----------------------------------------------------------------------
PF01212         ----------------------------------------------------------------------
PF01041         gt--------------------------------------------------------------------
PF01041         gt--------------------------------------------------------------------
PF00202         ----------------------------------------------------------------------
PF00202         ----------------------------------------------------------------------
PF01053         ----------------------------------------------------------------------