[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68197.1


[Show Plain Result]

## Summary of Sequence Search
   1::179
  76::151  PF00583 0.0% 24  Acetyltransferase (GNAT) family 
   1::179


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNMLLHQRGYAKMY
PF00583         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
PF00583         -----gelvGfaslsvigedgraertayieglaVspeyrgqGiGkaLleallekarerg.lerieleves


                         +         -         -         -         -         *         -:210
query           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD-------------------------------
PF00583         gndraiklYek-----------------------------------------------------------