[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68332.1


[Show Plain Result]

## Summary of Sequence Search
   1::429
  22::381  PF07690 0.0% 27.1137026239067  Major Facilitator Superfamily 
   1::429


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSITLLDGVVKKNRARLIPFMLALYVLAFLDRSNIGFAKETYQIDTGLSNEAYALGAGIFFVVYAFLGVP
PF07690         ---------------------llaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasl


                         -         -         *         -         -         -         -:140
query           ANLLMRKFGARTWIGTTTLLWGFLSAAMAWADSEAKFLIIRTLLGAAEAGFFPGMIYLTSQWFPQRNRAS
PF07690         laGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeer


                         +         -         -         -         -         *         -:210
query           IMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFVIEGLLAIGAGIFTFFWLDDTPQQARFLSLE
PF07690         gralgllsagfslGailgpllggllasslg......WravFlilailsllaavlvllllprepperkrks


                         -         -         -         +         -         -         -:280
query           EKNALIRQLASEEEKKVTSRLADALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVV
PF07690         paeel........rkepaplvpawklllkppvlw.llialllfffvfsglltllplylqevlglsp..gl


                         -         *         -         -         -         -         +:350
query           TAVPWVAALLGTWLIPRYSDRTGDRRNVAAVTLLAAGIGIGLSGLVSPVLAILALCVAAVGFIAVQPVFW
PF07690         llaglllgllaligaigalllgrlsdrlgrrrrlllallllllaalglallaftssavwllvvlvliGfg


                         -         -         -         -         *         -         -:420
query           TMPTQLLSGTALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLSGVAIIGSLIIFTLSVNRP
PF07690         lglvfptllalasdlappeerGtasglfnta---------------------------------------


                         -         -         +         -         -         -         -:490
query           VAQSGAAHH-------------------------------------------------------------
PF07690         ----------------------------------------------------------------------