[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68340.1


[Show Plain Result]

## Summary of Sequence Search
   1::172
  23::172  PF00419 0.0% 36.4864864864865  Fimbrial protein 
   1::172


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFA
PF00419         ----------------------GkvtFkGevveatCkvktesknqtVdLgqvsksaLkakgeksapvpft


                         -         -         *         -         -         -         -:140
query           IDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQAS
PF00419         IkLenCdtttakkakkvkltFsgnantekenklllknss.aAtnvgiqildangkkvklntatadavqll


                         +         -         -         -         -         *         -:210
query           AHLQFYARYLADGGAVTPGDANASATFILAYE--------------------------------------
PF00419         .nngentlhfiArykatgkatkaGevnAsanf--------------------------------------