[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68451.1


[Show Plain Result]

## Summary of Sequence Search
   1::368
   6::360  PF03054 0.0% 55.5555555555556  tRNA methyl transferase 
   5::76   PF02540 0.0% 37.5  NAD synthase 
 152::186  PF02540 0.0% 28.5714285714286  NAD synthase 
   6::89   PF00733 0.0% 25.974025974026  Asparagine synthase 
   6::76   PF02568 0.0% 34.2857142857143  Thiamine biosynthesis protein (ThiI) 
   7::73   PF06508 0.0% 32.2033898305085 PF06508 ExsB 
   1::368


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSESPKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELH
PF03054         -----kkvvvalSgGVDSsvaalllkeqgyevigvfmknweeedeegkeccaeedlkdaervaeklgipl
PF02540         ----akgvvlGlSGGvDSalvaalavkalgkenvlalimPssv........sseedvedalalaeklgie
PF02540         ----akgvvlGlSGGvDSalvaalavkalgkenvlalimPssv........sseedvedalalaeklgie
PF00733         -----vpvgvlLSGGlDSsliaalaaresskplktfsvgfeesead.......eagyaelvaehlgtehv
PF02568         -----gkvlaLlSgGiDSpVaaylllkRGcevvlvhfkneplks.eeaeekvrklaellaeyktelevkl
PF06508         ------kavvllSGGlDSttvlalakkegkevealtfdYgqrhkke........leaakkiakklgvehk


                         -         -         *         -         -         -         -:140
query           TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
PF03054         evvnfekeykekvfeefleeykkGrTPnPdvlCNkeiKfgallekakeelgadalatGHYarvsleeekn
PF02540         sktidi----------------------------------------------------------------
PF02540         sktidi----------------------------------------------------------------
PF00733         einvteeellealpevikh---------------------------------------------------
PF02568         vvvdfk----------------------------------------------------------------
PF06508         ild-------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LLRGLDGNKDQSYFLYTLGHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFRDFL
PF03054         evellraldkkkDQsyfLsqlskeqlekllfPlgeltKeevrkiAkeaglevaekkdSqgiCFigkrkfk
PF02540         -----------llvGyfTkyGDgacdlapiaellKtevyeLakrln------------------------
PF02540         -----------llvGyfTkyGDgacdlapiaellKtevyeLakrln------------------------
PF00733         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------
PF06508         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKDGSEDPWYVVDKDVENNVLIVAQGHEHP
PF03054         dflkkyleekeGkiidietgevlgeheGllsyTiGqrkGlklgg....leeplyVvekdaeknevvvskg
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------
PF06508         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RLMSVGLIAQQLHWVDREPFTGTLRCTVKTRYRQTDIPCTINALDDDRIEVIFDEPVAAVTPGQSAVFYS
PF03054         edkeallskellvkelnwlaeelkekealevevkvrhrqeevkakvklkedeevevklkekvravtpGQa
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------
PF06508         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GEVCLGGGIIEQRLPLTV----------------------------------------------------
PF03054         avlYkgdevL------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------
PF06508         ----------------------------------------------------------------------