[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68462.1


[Show Plain Result]

## Summary of Sequence Search
   1::305
   3::151  PF02558 0.0% 34.4594594594595  Ketopantoate reductase PanE/ApbA 
  10::86   PF08546 0.0% 24.5901639344262  Ketopantoate reductase PanE/ApbA C terminal 
 177::303  PF08546 0.0% 35.2  Ketopantoate reductase PanE/ApbA C terminal 
   1::50   PF03721 0.0% 34  UDP-glucose/GDP-mannose dehydrogenase family, NAD b 
   1::114  PF01210 0.0% 23.0088495575221  NAD-dependent glycerol-3-phosphate dehydrogenase N- 
   2::40   PF02737 0.0% 33.3333333333333  3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 
   1::103  PF03446 0.0% 23.0769230769231  NAD binding domain of 6-phosphogluconate dehydrogen 
   1::305


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIAIAGAGAMGCRFGYMLLEAGHDVTLIDGWQEHVDAIRSKGLFVETETTQKYYPIPAMLADESQGEFE
PF02558         --iailGaGaiGsllaakLakagadvtlilrsr.rlealkknglrlksdkgeeivrppealseekqelep
PF08546         ---------lldctngellespelralvralmdEalavakaeg...............valseeeleeev
PF08546         ---------lldctngellespelralvralmdEalavakaeg...............valseeeleeev
PF03721         mkiaviGlGYvGlptavvlaekghevvgvDineekvdklnsgkipiyEpg--------------------
PF01210         kkvavlGaGswGtalAkvlaenghevrlWvreeklieeinerrenvkylpg.iklpenlvattDleealk
PF02737         -kvaVvGaGtmGagiAavfaragleVvlvdiseealekal------------------------------
PF03446         kkigfiGlGvMGsnmarnllkagykvavydrtkekveelvaeg........aeaaesieefvasl....d


                         -         -         *         -         -         -         -:140
query           LVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNGLGNIETLEKYVDRQKIYAGVTLWSSELEGAGHIMAT
PF02558         idllivtvKayqteealeelkplldpntvvlllqNGlgheeelrealpkenvlggvtthgatregpgevh
PF08546         arvarktaan.ksSMl------------------------------------------------------
PF08546         arvarktaan.ksSMl------------------------------------------------------
PF03721         ----------------------------------------------------------------------
PF01210         gadiivlvVPsqflrevlkklkgllkkdailvsltKGieegtlk--------------------------
PF02737         ----------------------------------------------------------------------
PF03446         vvilmvpagkavdeviegekgllealekgdili-------------------------------------


                         +         -         -         -         -         *         -:210
query           GTGTIELQPIASQDSAQEAKVIATLNSAGLNAEISPDVLLSIWKKAAFNSVMNTYCALLDCNVGGFGQRP
PF02558         hagsgeikige-----------------------------------------------------------
PF08546         ------------------------------------dirlarweKllvnaainpltalldctngellesp
PF08546         ------------------------------------dirlarweKllvnaainpltalldctngellesp
PF03721         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------
PF03446         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GALDLAQAVVDEFVLVAASQNIPLTEQMVMNTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIAR
PF02558         ----------------------------------------------------------------------
PF08546         elralvralmdEalavakaegvalseeeleeevarvarktaa..nksSMlqDveagrktEidyinGyvvk
PF08546         elralvralmdEalavakaegvalseeeleeevarvarktaa..nksSMlqDveagrktEidyinGyvvk
PF03721         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------
PF03446         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IGAQNNIAVPVNKLLTQLIHAKEAQ---------------------------------------------
PF02558         ----------------------------------------------------------------------
PF08546         lakklgvetPvnellyelvkaie-----------------------------------------------
PF08546         lakklgvetPvnellyelvkaie-----------------------------------------------
PF03721         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------
PF03446         ----------------------------------------------------------------------