[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68493.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
 238::274  PF00165 0.0% 22.2222222222222  Bacterial regulatory helix-turn-helix proteins, Ara 
 290::323  PF00165 0.0% 24.2424242424242  Bacterial regulatory helix-turn-helix proteins, Ara 
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQSSPVLHGDIEEIALPGGICITRSDVH
PF00165         ----------------------------------------------------------------------
PF00165         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTFLLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMY
PF00165         ----------------------------------------------------------------------
PF00165         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PDGGWRERLPVSLADEWENSATSARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQ
PF00165         ----------------------------------------------------------------------
PF00165         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PATQKRGLPVTGEYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLA
PF00165         ---------------------------stn.wsiadiAeevgfSpsyfsrlFkkytGvtPsqyr------
PF00165         ---------------------------stn.wsiadiAeevgfSpsyfsrlFkkytGvtPsqyr------


                         -         *         -         -         -         -         +:350
query           RARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA----------------
PF00165         ---------wsiadiAeevgf.SpsyfsrlFkkytGvtPsqyr---------------------------
PF00165         ---------wsiadiAeevgf.SpsyfsrlFkkytGvtPsqyr---------------------------