[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68510.1


[Show Plain Result]

## Summary of Sequence Search
   1::555
  28::337  PF00749 0.0% 43.3224755700326  tRNA synthetases class I (E and Q), catalytic domai 
 340::529  PF03950 0.0% 53.4883720930233  tRNA synthetases class I (E and Q), anti-codon bind 
   1::555


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQGQCNLRFDDTN
PF00749         ---------------------------VrtrfaPsPtGyLHiGhaktallnyllAkkanGkfilRieDTd
PF03950         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAP
PF00749         perekeeaeesiledlkwlglkwdekptrqSdrfdelkkyaeeLiekGkaYvcfctkEeleeereeqe..
PF03950         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GKNSPFRDRSVEENLALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
PF00749         klgskerdrydeenlklfeeemkkgeaegekavlRlkideesp.vemrDlvrgrikfepselhdlvllks
PF03950         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
PF00749         dgyPtYdfavvidDalmeiThvlrgeeflantpkyiwllealglevppfahlslllnlegkklSKRklsl
PF03950         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
PF00749         lvdislvkeegdlreallnflarlGwspeaeeefltreeliksfdlnresksleafd-------------
PF03950         -----------------------------------------------------------ApRymaVldpv


                         -         -         -         -         *         -         -:420
query           KLVIENYPQGESEMVTMPNHPNKPEMGSREVPFSGEIWIDRADFREEANKQYKRLVMGKEVRLRNAYVIK
PF00749         ----------------------------------------------------------------------
PF03950         kvtienlpegkeeelevplhpknpelgerevpfskeiyiereD........akrlkpgeevrLkelynik


                         -         -         +         -         -         -         -:490
query           AERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPIEIRLYDRLFSVPNPGAAEDFL
PF00749         ----------------------------------------------------------------------
PF03950         veev.kdesgevtelkleydgesleea....rkkkgiihWvsakeaveaevrlYdrLfkeed.dk..dfl


                         *         -         -         -         -         +         -:560
query           SVINPESLVIKQGYGEPSLKAAVAGKAFQFEREGYFCLDSRYATADKLVFNRTVGLRDTWAKAGE-----
PF00749         ----------------------------------------------------------------------
PF03950         ..lnpdslkvleeglaepalanlkkgdivQfeRiGYfrv-------------------------------