[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68527.1


[Show Plain Result]

## Summary of Sequence Search
   1::722
 211::228  PF07661 0.0% 44.4444444444444  MORN repeat variant 
 238::255  PF07661 0.0% 27.7777777777778  MORN repeat variant 
 259::277  PF07661 0.0% 42.1052631578947  MORN repeat variant 
 283::304  PF07661 0.0% 40.9090909090909  MORN repeat variant 
 307::326  PF07661 0.0% 45  MORN repeat variant 
 332::352  PF07661 0.0% 33.3333333333333  MORN repeat variant 
 357::377  PF07661 0.0% 52.3809523809524  MORN repeat variant 
 384::399  PF07661 0.0% 37.5  MORN repeat variant 
 404::425  PF07661 0.0% 40.9090909090909  MORN repeat variant 
 428::449  PF07661 0.0% 45.4545454545455  MORN repeat variant 
 452::473  PF07661 0.0% 40.9090909090909  MORN repeat variant 
 526::546  PF07661 0.0% 42.8571428571429  MORN repeat variant 
 569::599  PF08238 0.0% 38.7096774193548  Sel1 repeat 
 602::634  PF08238 0.0% 45.4545454545455  Sel1 repeat 
 636::671  PF08238 0.0% 41.6666666666667  Sel1 repeat 
 672::706  PF08238 0.0% 51.4285714285714  Sel1 repeat 
 198::321  PF09318 0.0% 17.7966101694915  Domain of unknown function (DUF1975) 
 354::423  PF09318 0.0% 23.5294117647059  Domain of unknown function (DUF1975) 
 471::549  PF09318 0.0% 20.253164556962  Domain of unknown function (DUF1975) 
   1::722


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIFITIIVSLYCANICAKQSPSTESKPVNFIAQIENIDFNKTAISSDLKLLLADRYYFKDKTPCNTNT
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LSARAESMGLTTEEYINKIRSLRPAILDDRYFYLTVDQCDAGGTPMLTGIELCTEALCGAEYMKRSSDLW
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LDDELQPTVKRQATTVVHMPLPYDKEKKLWKVTGWYLESSEETGEVMQSKQIAFEGYTNEENFANRQRVS
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF09318         ---------------------------------------------------------lkelglkdtevin
PF09318         ---------------------------------------------------------lkelglkdtevin
PF09318         ---------------------------------------------------------lkelglkdtevin


                         -         -         -         +         -         -         -:280
query           VFKSFYESGNLKSIYHYNAQNKRDGKAETYFDEKDKIAETLTFKDGQPEGEYIVYHENGAVESKRYFAQG
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF07661         eekeYyenGklkseitYk---------ekeYyenGklkseitYkn---eGeekeYyenGklkseitY---
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF09318         lYdyfqdiisvktkkkidl.ykdlslpkaleveene.kdvriydkggqliarvnyrdetkgrvsyveyfd
PF09318         lYdyfqdiisvktkkkidl.ykdlslpkaleveene.kdvriydkggqliarvnyrdetkgrvsyveyfd
PF09318         lYdyfqdiisvktkkkidl.ykdlslpkaleveene.kdvriydkggqliarvnyrdetkgrvsyveyfd


                         -         *         -         -         -         -         +:350
query           KIKDGECPHFYDNGVLKQKHSYLNQKLEGPAFEYFPDGKIKGKYSYSKGTIVGTSTEYYSTGKIRGVYHR
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF07661         --leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitY-----eGeekeYyenGklkseitY
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF09318         sngrl...irrdyYdsrgflsltqyfdd.dgkvileeyynp-----------------------------
PF09318         sngrl...irrdyYdsrgflsltqyfdd.dgkvileeyynp-----------------------------
PF09318         sngrl...irrdyYdsrgflsltqyfdd.dgkvileeyynp-----------------------------


                         -         -         -         -         *         -         -:420
query           NNQGENDGTFEQYSEEGKLLSKATYKNGKQLSAQSWYENGHPKEESSFDSEGRKHGAVKEWFSNGKPASS
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF07661         kn----eGeekeYyenGklkseitYkn------keYyenGklkseitYk----leGeekeYyenGklkse
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF09318         ---eenekdvriydkggqliarvnyrdetkgrvsyveyfdsngrlirrdyYdsrgfls..ltqyfdddgk
PF09318         ---eenekdvriydkggqliarvnyrdetkgrvsyveyfdsngrlirrdyYdsrgfls..ltqyfdddgk
PF09318         ---eenekdvriydkggqliarvnyrdetkgrvsyveyfdsngrlirrdyYdsrgfls..ltqyfdddgk


                         -         -         +         -         -         -         -:490
query           KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGADRRWSERTGKL
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF07661         itYkn--leGeekeYyenGklkseitYkn--leGeekeYyenGklkseitYkn-----------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF09318         vil-----------------------------------------------iydkggqliarvnyrdetkg
PF09318         vil-----------------------------------------------iydkggqliarvnyrdetkg
PF09318         vil-----------------------------------------------iydkggqliarvnyrdetkg


                         *         -         -         -         -         +         -:560
query           VEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKYIRCYHNDEELSELYAPTDVT
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF07661         -----------------------------------leGeekeYyenGklkseitYk--------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF08238         ----------------------------------------------------------------------
PF09318         rvsyveyfdsngrlirrdyYdsrgflsltqyfdddgkvileeyynpdgsivleeyykkn-----------
PF09318         rvsyveyfdsngrlirrdyYdsrgflsltqyfdddgkvileeyynpdgsivleeyykkn-----------
PF09318         rvsyveyfdsngrlirrdyYdsrgflsltqyfdddgkvileeyynpdgsivleeyykkn-----------


                         -         -         -         *         -         -         -:630
query           NKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHPGALLFLAYAYNDGDGVAQDSKKYLSYLFKA
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF08238         --------eAqynLGlyymylnGlgGvpkdpekAleWye--AqynLGlyymylnGlgGvpkdpekAleWy
PF08238         --------eAqynLGlyymylnGlgGvpkdpekAleWye--AqynLGlyymylnGlgGvpkdpekAleWy
PF08238         --------eAqynLGlyymylnGlgGvpkdpekAleWye--AqynLGlyymylnGlgGvpkdpekAleWy
PF08238         --------eAqynLGlyymylnGlgGvpkdpekAleWye--AqynLGlyymylnGlgGvpkdpekAleWy
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           AELGESDAQLEVGYLNLIGEGMPKNLPEAYKWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAKLHLT
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF08238         ekAA-aeAqynLGlyymylnGlgGvpkdpekAleWyekAAeaeAqynLGlyymylnGlgGvpkdpekAle
PF08238         ekAA-aeAqynLGlyymylnGlgGvpkdpekAleWyekAAeaeAqynLGlyymylnGlgGvpkdpekAle
PF08238         ekAA-aeAqynLGlyymylnGlgGvpkdpekAleWyekAAeaeAqynLGlyymylnGlgGvpkdpekAle
PF08238         ekAA-aeAqynLGlyymylnGlgGvpkdpekAleWyekAAeaeAqynLGlyymylnGlgGvpkdpekAle
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AAVKGGVKPALAALKELTPQTK------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF07661         ----------------------------------------------------------------------
PF08238         WyekAA----------------------------------------------------------------
PF08238         WyekAA----------------------------------------------------------------
PF08238         WyekAA----------------------------------------------------------------
PF08238         WyekAA----------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------