[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68589.1


[Show Plain Result]

## Summary of Sequence Search
   1::157
  12::154  PF07295 0.0% 45.4545454545455  Protein of unknown function (DUF1451) 
   1::157


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKVAQYYRELVASLSERLRNGERDIDALVEQARQRVMQTGELTRTEVDELTRAVRRDLEEFAMSYEESQ
PF07295         -----------lerlketekksekelkeaiekakealkaaeeltkeelalieeylkrDleefaesveelk


                         -         -         *         -         -         -         -:140
query           EDSVFLRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKCHYHLAVYTPDVLP
PF07295         ekesldlqlleeslwdeLseitDrtqveweelaqdlehqgvYqsGevvglGeLvCekCghklelekpsei


                         +         -         -         -         -         *         -:210
query           LCPKCGHDQFQRRPFEP-----------------------------------------------------
PF07295         eaCpkCgkkeFeRe--------------------------------------------------------