[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68745.1


[Show Plain Result]

## Summary of Sequence Search
   1::408
 145::394  PF00657 0.0% 22.5  GDSL-like Lipase/Acylhydrolase 
   1::108  PF06767 0.0% 28.8461538461538  Sif protein 
   1::408


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLSVGQGYFTSFISSEKFNAIKESARLPELSLWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPVQVR
PF00657         ----------------------------------------------------------------------
PF06767         mpitigngylkseilitppkktreaww...kvlwerlkdfffstgkakadsylhemlfads.pptrerla


                         -         -         *         -         -         -         -:140
query           GAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEAFGLAKEINKSHPKPKNISLG
PF00657         ----------------------------------------------------------------------
PF06767         diffelkalacashkdrfqvynpheddatiifrilden--------------------------------


                         +         -         -         -         -         *         -:210
query           DITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSAS
PF00657         ----ivafGDSltdg..............ggdsngggwvaglanrltsanrlnqkppgvdvfnrgisGrt
PF06767         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLV
PF00657         sdgrlvrlksqa.........lnllqelkkllpkkdykspdlvtidiGtNDlitaeslkqdqnasvpefl
PF06767         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MGIPDLSLTPYGKHSDEKRKLKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYD
PF00657         dnlrsllkrlylegarlivlltfvlhnlgplgalasarskkkdakgclerlneaaklfnellkklaeqlr
PF06767         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TENPYTHHGYVHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYSTE------------
PF00657         kdlpkdanvtyvDiysifsdldlqnpsny...............--------------------------
PF06767         ----------------------------------------------------------------------