[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for sent8:ACF68874.1


[Show Plain Result]

## Summary of Sequence Search
   1::286
  20::127  PF02678 0.0% 49.0384615384615 PF02678 Pirin 
  63::100  PF05726 0.0% 31.5789473684211  Pirin C-terminal cupin domain 
 183::284  PF05726 0.0% 46.5346534653465  Pirin C-terminal cupin domain 
   1::286


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKQITGVYTAPRPHWVGDGFPVRSLFSYQSHAQQLSPFLLLDYAGPHTFTPGNEKRGVGEHPHRGFETVT
PF02678         -------------------vrvrralgkaawlqlvdpFlfldhfgpaklsagedelgagfppHpHrglet
PF05726         --------------------------------------------------------------pegfeafv
PF05726         --------------------------------------------------------------pegfeafv


                         -         -         *         -         -         -         -:140
query           IVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGELEMVQLWVNLPMKDKMTPPGY
PF02678         vtylleGeiehrDslGnkgvirpgdvqwmtAGsGivHsEmpeee....eeslhglQl-------------
PF05726         yvleGsvevegersaieeeslvvlgdgdsl----------------------------------------
PF05726         yvleGsvevegersaieeeslvvlgdgdsl----------------------------------------


                         +         -         -         -         -         *         -:210
query           QSITHDVIPTVTLPDNAGVVRVIAGRYEETKGPAHTFSPLNVWDMRLQRNRQLTLAQPEGWSTALVVLKG
PF02678         ----------------------------------------------------------------------
PF05726         ------------------------------------------ldvtleagakfelplpegfeafvyvleG
PF05726         ------------------------------------------ldvtleagakfelplpegfeafvyvleG


                         -         -         -         +         -         -         -:280
query           NITVNGTTPVNEAQLVVLSQQGKTLHLEASSDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFNS
PF02678         ----------------------------------------------------------------------
PF05726         svevegersaieeeslvvlg.dgdslevkaeekgarvlllaGePigepvviyGpfVmntkeeieqAfedy
PF05726         svevegersaieeeslvvlg.dgdslevkaeekgarvlllaGePigepvviyGpfVmntkeeieqAfedy


                         -         *         -         -         -         -         +:350
query           GRFGQI----------------------------------------------------------------
PF02678         ----------------------------------------------------------------------
PF05726         regr------------------------------------------------------------------
PF05726         regr------------------------------------------------------------------